Recombinant Vaccinia virus Protein A38 (VACWR162)

Code CSB-CF333019VAI
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P24763
Storage Buffer Tris-based buffer,50% glycerol
Species Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
Sequence MSRVRISLIYLCTFMIITSTKTIEYTACNNTIIIPCTIDNPTKYIRWKLDNHDILTYNKT SKTTILSKWHTSARLHSLSDSDVSLIIEYKDILPGTYTCEDNTGIKSTVKLVQRHTNWFN DYQTMLMFIFTGITLFLLFLEITYTSISVVFSTNLGILQVFGCVIAMIELCGAFLFYPSM FTLRHIIGLLMMTLPSIFLIITKVFSFWLLCKLSCAVHLIIYYQLAGYILTVLGLGLSLK ECVDGTLLLSGLGTIMVSEHFSLLFLVCFPSTQRDYY
Source in vitro E.coli expression system
Gene Names VACWR162
Protein Names Recommended name: Protein A38
Expression Region 1-277
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Promotes, when overexpressed, the influx of extracellular Ca2+, leading to membrane permeability and host cell necrosis.
Subcellular Location Host membrane, Multi-pass membrane protein
Protein Families Chordopoxvirinae A38 protein family

Related Products

VACWR162 Proteins

VACWR162 Proteins for Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.