Recombinant Vaccinia virus Viral replication protein A28 (VACWR151)

Code CSB-CF300757VAI
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P68633
Storage Buffer Tris-based buffer,50% glycerol
Species Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
Sequence MNSLSIFFIVVATAAVCLLFIQGYSIYENYGNIKEFNATHAAFEYSKSIGGTPALDRRVQDVNDTISDVKQKWRCVVYPGNGFVSASIFGFQAEVGPNNTRSIRKFNTMQQCIDFTFSDVININIYNPCVVPNINNAECQFLKSVL
Source in vitro E.coli expression system
Gene Names VACWR151
Protein Names Recommended name: Viral replication protein A28
Expression Region 1-146
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Envelope protein required for virus entry into host cell and for cell-cell fusion (syncytium formation).
Subcellular Location Virion membrane, Single-pass type III membrane protein
Protein Families Poxviridae A28 protein family

Related Products

VACWR151 Proteins

VACWR151 Proteins for Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.