Recombinant Vanderwaltozyma polyspora Vacuolar ATPase assembly integral membrane protein VMA21(VMA21)

Code CSB-CF025866VDW
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A7TSA7
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)
Sequence MPVDVAPGVIKKLMFFTAAMVICPLLTFFSIKQFTTNTIVSGGLAALAANLVLIGYIVVAFMEDTTDVKAESKKD
Source in vitro E.coli expression system
Gene Names VMA21
Protein Names Recommended name: Vacuolar ATPase assembly integral membrane protein VMA21
Expression Region 1-75
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) in the endoplasmic reticulum.
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein, Endoplasmic reticulum-Golgi intermediate compartment membrane, Multi-pass membrane protein, Cytoplasmic vesicle, COPII-coated vesicle membrane, Multi-pass membrane protein
Protein Families VMA21 family
Database Links

KEGG: vpo:Kpol_359p4

STRING: 436907.XP_001642702.1

Related Products

VMA21 Proteins

VMA21 Proteins for Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.