Recombinant Vanderwaltozyma polyspora Vacuolar ATPase assembly integral membrane protein VMA21(VMA21)

Code CSB-CF025866VDW
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A7TSA7
Storage Buffer Tris-based buffer,50% glycerol
Species Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)
Sequence MPVDVAPGVIKKLMFFTAAMVICPLLTFFSIKQFTTNTIVSGGLAALAANLVLIGYIVVAFMEDTTDVKAESKKD
Source in vitro E.coli expression system
Gene Names VMA21
Protein Names Recommended name: Vacuolar ATPase assembly integral membrane protein VMA21
Expression Region 1-75
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) in the endoplasmic reticulum.
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein, Endoplasmic reticulum-Golgi intermediate compartment membrane, Multi-pass membrane protein, Cytoplasmic vesicle, COPII-coated vesicle membrane, Multi-pass membrane protein
Protein Families VMA21 family
Database Links

KEGG: vpo:Kpol_359p4

STRING: 436907.XP_001642702.1

Related Products

VMA21 Proteins

VMA21 Proteins for Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.