Recombinant Verminephrobacter eiseniae UPF0761 membrane protein Veis_3782 (Veis_3782)

Code CSB-CF380462VDX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A1WPD7
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Verminephrobacter eiseniae (strain EF01-2)
Sequence MSLPFSLSVAARRIEALLGDLSRFPWKTTAQTLRERFRADHLGLTASSLTFTTILALVPF FTVALAVFTAFPIFGQLQDALQGWLVSSLVPDSIARQVLGYLTQFAAKASGLGLAGFSVL LVTALALILTIDRTLNDIWRVQRLRPLGQRVLIYWAAITLGPLLLGASLALTSYVMSASG GLVKRLPDGVRFLFDSLQFMVLAAGMALLYHYVPNTPVRWRHAWSGGLFVALCIELAKKA LALYLGRVPTYSVVYGAFATLPILLVWIYMAWVIVLLGAVVTAYLPSLLAGVARRGTVAG WTFQLALEVLQQLHRVRHDAGKGLRAGQLAQLLRVDVLQLEPVLESLTALDWVGQVSAVV VAASDPPEPRYVLLADPQSTLLEPLVHKLLLERSESLGPLWDKAGLGRLQMADVLAR
Source in vitro E.coli expression system
Gene Names Veis_3782
Protein Names Recommended name: UPF0761 membrane protein Veis_3782
Expression Region 1-417
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families UPF0761 family
Database Links

KEGG: vei:Veis_3782

STRING: 391735.Veis_3782

Related Products

Veis_3782 Proteins

Veis_3782 Proteins for Verminephrobacter eiseniae (strain EF01-2)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.