Recombinant Vibrio cholerae serotype O1 UPF0761 membrane protein VC0395_A2314/VC395_2854 (VC0395_A2314, VC395_2854)

Code CSB-CF399951VEY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A5F4Q8
Storage Buffer Tris-based buffer,50% glycerol
Species Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Sequence MKLTHSFIKQQARLGLNFFRYLLARMNHDRVNVNAGYLAYITLLSMVPMLTVLLSILSSF ALFANAGEVIQDFVITHFVPAAGEVVKTALIEFVANTGKMTAVGGAFLFVAAIMLISNID KNLNYIWRVQQKRRAVFSFSMYWMILTLGPILVGASIAATSYITSLKILDNEALSGVYNL FLRWLPFVLSYCAFVGLYLLVPNKKVHWQHAMLGALIAAILFELSKKGFAAYITQFPSYQ LIYGALAAIPILFVWVYLCWLIVLVGAEVTAALGEREHWSDSQDMLHFAPLPKNEKE
Source in vitro E.coli expression system
Gene Names VC0395_A2314
Protein Names Recommended name: UPF0761 membrane protein VC0395_A2314/VC395_2854
Expression Region 1-297
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families UPF0761 family
Database Links

KEGG: vco:VC0395_A2314

STRING: 345073.VC0395_A2314

Related Products

VC0395_A2314 Proteins

VC0395_A2314 Proteins for Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.