Recombinant Vibrio vulnificus UPF0283 membrane protein VV2076(VV2076)

Code CSB-CF762688VCQ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q7MJT4
Storage Buffer Tris-based buffer,50% glycerol
Species Vibrio vulnificus (strain YJ016)
Sequence MSDLKPKQVFEETIFSQQDKPELTAQQQFDQQQTFIPTTIEETEPELEDALEQVIRPSGR RKWLAGGLFAAFAGLVGWQAVDSVLSAMQNGDWLTLGWSGFISVLAGLGLGAMGKELWKL RQLRHLFSVQEQGEKLLQSDSVGQGKAFCQQVAKQSGVAEENPAYDRWKNSVNTAHSDAE ILQMYDAMVVTQQDKQATKVISRFATESAALVAISPLAIADMLLVAWRNFKMIDTLSTIY GIELGYASRIRLLRLVLANMAVAGASELVIDAGMDLMSMDLAGKLSARAGQGVGVGILTA RLGLKAMALLRPIPWQAETQVKLSAIRKEIVSKVASITLKP
Source in vitro E.coli expression system
Gene Names VV2076
Protein Names Recommended name: UPF0283 membrane protein VV2076
Expression Region 1-341
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families UPF0283 family
Database Links

KEGG: vvy:VV2076

Related Products

VV2076 Proteins

VV2076 Proteins for Vibrio vulnificus (strain YJ016)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.