Recombinant Vitis vinifera CASP-like protein VIT_07s0104g01350 (VIT_07s0104g01350)

Code CSB-CF417839VFQ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A7PTY8
Storage Buffer Tris-based buffer,50% glycerol
Species Vitis vinifera (Grape)
Sequence MESQCRPNVDGVHNGVESHVKVVEKPRSVGSSSEFVLRILGLLLTLIAAVVAGVDKQTKI IPLTLIKTLPSLHVPVTAKWSDMSAFVYLVVSNAIACSYAAISLVLVTMLGRRGKGGRVL AVIVLDLHMVGLLFSANGAATAVGVLGQYGNSHVEWKKVCNVFDSFCHHLVASLALSFLG SLSFLGLVLLAILNLHKKSSTK
Source in vitro E.coli expression system
Gene Names VIT_07s0104g01350
Protein Names Recommended name: CASP-like protein VIT_07s0104g01350
Expression Region 1-202
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Casparian strip membrane proteins (CASP) family
Database Links

KEGG: vvi:100244310

UniGene: Vvi.15246

Related Products

VIT_07s0104g01350 Proteins

VIT_07s0104g01350 Proteins for Vitis vinifera (Grape)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.