Recombinant Xanthomonas campestris pv. campestris Type 4 prepilin-like proteins leader peptide-processing enzyme(xpsO)

Code CSB-CF690910XAY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q56763
Storage Buffer Tris-based buffer,50% glycerol
Species Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Sequence MAFLDQHPGLGFPAAAGLGLLIGSFLNVVILRLPKRMEWQWRRDAREILELPDIYEPPPP GIVVEPSHDPVTGDKLKWWENIPLFSWLMLRGKSRYSGKPISIQYPLVELLTSILCVASV WRFGFGWQGFGAIVLSCFLVAMSGIDLRHKLLPDQLTLPLMWLGLVGSMDNLYMPAKPAL LGAAVGYVSLWTVWWLFKQLTGKEGMGHGDFKLLAALGAWCGLKGILPIILISSLVGAVL GSIWLFAKGRDRATPIPFGPYLAIAGWVVFFWGNDLVDGYLRFAGLR
Source in vitro E.coli expression system
Gene Names xpsO
Protein Names Recommended name: Type 4 prepilin-like proteins leader peptide-processing enzyme Including the following 2 domains: Leader peptidase EC= 3.4.23.43 Alternative name(s): Prepilin peptidase N-methyltransferase EC= 2.1.1.-
Expression Region 1-287
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cleaves type-4 fimbrial leader sequence and methylates the N-terminal (generally Phe) residue.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families Peptidase A24 family
Database Links

KEGG: xcc:XCC3101

STRING: 190485.XCC3101

Related Products

xpsO Proteins

xpsO Proteins for Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.