Recombinant Xanthomonas campestris pv. campestris Type II secretion system protein F(xpsF)

Code CSB-CF333633XAY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P31744
Storage Buffer Tris-based buffer,50% glycerol
Species Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Sequence MPLYRYKALDAHGEMLDGQMEAANDAEVALRLQEQGHLPVETRLATGENGSPSLRMLLRK KPFDNAALVQFTQQLATLIGAGQPLDRALSILMDLPEDDKSRRVIADIRDTVRGGAPLSV ALERQHGLFSKLYINMVRAGEAGGSMQDTLQRLADYLERSRALKGKVINALIYPAILLAV VGCALLFLLGYVVPQFAQMYESLDVALPWFTQAVLSVGLLVRDWWLVLVVIPGVLGLWLD RKRRNAAFRAALDAWLLRQKVIGSLIARLETARLTRTLGTLLRNGVPLLAAIGIARNVMS NTALVEDVAAAADDVKNGHGLSMSLARGKRFPRLALQMIQVGEESGALDTMLLKTADTFE LETAQAIDRALAALVPLITLVLASVVGLVIISVLVPLYDLTNAIG
Source in vitro E.coli expression system
Gene Names xpsF
Protein Names Recommended name: Type II secretion system protein F Short name= T2SS protein F Alternative name(s): General secretion pathway protein F
Expression Region 1-405
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in a type II secretion system (T2SS, formerly general secretion pathway, GSP) for the export of proteins.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families GSP F family
Database Links

KEGG: xcc:XCC0661

STRING: 190485.XCC0661

Related Products

xpsF Proteins

xpsF Proteins for Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.