Recombinant Xanthomonas campestris pv. campestris UPF0060 membrane protein XC_1229(XC_1229)

Code CSB-CF706275XAF
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q4UXC5
Storage Buffer Tris-based buffer,50% glycerol
Species Xanthomonas campestris pv. campestris (strain 8004)
Sequence MSVALTTLLLFVATAVAELVGCYLPYLWLRKGGSVWLLLPAALSLAVFVWLLTLHPAASG RVYAAYGGVYIATALLWLWWVDRVTPTRWDLLGAGCCLLGMAIIMFSPRSG
Source in vitro E.coli expression system
Gene Names XC_1229
Protein Names Recommended name: UPF0060 membrane protein XC_1229
Expression Region 1-111
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families UPF0060 family
Database Links

KEGG: xcb:XC_1229

STRING: 314565.XC_1229

Related Products

XC_1229 Proteins

XC_1229 Proteins for Xanthomonas campestris pv. campestris (strain 8004)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.