Recombinant Xanthomonas campestris pv. campestris UPF0761 membrane protein XCC0860(XCC0860)

Code CSB-CF854341XAY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8PC75
Storage Buffer Tris-based buffer,50% glycerol
Species Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Sequence MSRVNTMHQWKERLRDRARTASFGRFLWRRFLDDRLFQAAASLAYTTVFALVPLAIVVFG VLSAFPAFNEWKDALTDFIFNNFVPGAARSVQNYLNRSLEDLGKFTVAGMVALVASLLIT LHSIEQTFNSIWRVAAARPKVTRFLIYWTVLTLGTMLAAASMAMAAYVFALPLFRTTEGQ WLAEFAWRLAPMAVEFVCIVLIYRVVPQHAVRLRHALPGALLAVILMEIVKWGFGFYLGN FQTYQRIYGALSALPILLLWIYLSWVSVLLGASLASSMSAFRYQPEAMRLPPGFEIYGLL RLLGRFRQARLHGNGLDEDRILALEPMLTDTLMQELLCELKRIRLLRRDERGNWLLARDL DVVPLAELYESCQLRVPVEDRPLPCRDDPYGQAAAAALEQLRQPLRSVLAQPVGDLYTHL PGDPP
Source in vitro E.coli expression system
Gene Names XCC0860
Protein Names Recommended name: UPF0761 membrane protein XCC0860
Expression Region 1-425
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families UPF0761 family
Database Links

KEGG: xcc:XCC0860

STRING: 190485.XCC0860

Related Products

XCC0860 Proteins

XCC0860 Proteins for Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.