Recombinant Xanthomonas campestris pv. vesicatoria UPF0060 membrane protein XCV3198(XCV3198)

Code CSB-CF666816XAAC
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q3BQN4
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Xanthomonas campestris pv. vesicatoria (strain 85-10)
Sequence MTIAPTTLLLFAATALAELVGCYLPYLWLRKGGSMWLLLPTALSLAVFVWLLSLHPEASG RVYAAYGGVYIASALLWLWWVDGVTPTRWDLLGAACCLLGMAVIMFSPRSA
Source in vitro E.coli expression system
Gene Names XCV3198
Protein Names Recommended name: UPF0060 membrane protein XCV3198
Expression Region 1-111
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families UPF0060 family
Database Links

KEGG: xcv:XCV3198

STRING: 316273.XCV3198

Related Products

XCV3198 Proteins

XCV3198 Proteins for Xanthomonas campestris pv. vesicatoria (strain 85-10)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.