Recombinant Xanthomonas campestris pv. vesicatoria UPF0060 membrane protein XCV3198(XCV3198)

Code CSB-CF666816XAAC
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q3BQN4
Storage Buffer Tris-based buffer,50% glycerol
Species Xanthomonas campestris pv. vesicatoria (strain 85-10)
Sequence MTIAPTTLLLFAATALAELVGCYLPYLWLRKGGSMWLLLPTALSLAVFVWLLSLHPEASG RVYAAYGGVYIASALLWLWWVDGVTPTRWDLLGAACCLLGMAVIMFSPRSA
Source in vitro E.coli expression system
Gene Names XCV3198
Protein Names Recommended name: UPF0060 membrane protein XCV3198
Expression Region 1-111
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families UPF0060 family
Database Links

KEGG: xcv:XCV3198

STRING: 316273.XCV3198

Related Products

XCV3198 Proteins

XCV3198 Proteins for Xanthomonas campestris pv. vesicatoria (strain 85-10)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.