Recombinant Xanthomonas oryzae pv. oryzae Glucans biosynthesis glucosyltransferase H(opgH)

Code CSB-CF648419XAAB
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q2NYU0
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Sequence MDGTVTLSSTPTAIPPVSALDAGKPTLPPEAPLAMPEQNLREGSLQVRHQRTSPPGIGMR RFYLIGGTFAATAVAVWVMLSVLWPDGISVLEGCLLCLFTLLFAWIAMSFASAVAGFVTV VARAGRKLGIDPEEPLPTLRSRTALLMPTYNEDPRRLLAGLQAIYESVAETGQLEHFDFF VLSDTTREHIGRAEELVYSELCDRVDGHGRIFYRRRADNAARKAGNVADWVRRFGGRYPQ MLILDADSVMTGDTIVRLVAGMENNPDVGLIQTLPAVVNGQTLFARMQQFGGRVYGPIIA FGVAWWHGAESNYWGHNAIIRTHAFADHAGLPSLRGRKPFGGHVLSHDFVEAALMRRGGW AMHMVPYLQGSYEEGPPTLTDLLIRDRRWCQGNLQHAKVVSAKGLHWISRMHMLIGIGHY FTAPMWGLLMLIGIGIPLAGVGIDLAGDLPFSPARYWHGSSQGNAIWIFICTMFVLLAPK LLGYIALLLNPRELRACGGAFRAAVSILLETVLAALMAPVVMYLQSRGVFEVLAGKDSGW DAQVRDDGKLSWPALLRSYGGLTVFGLFMGAVAYAVSPALAAWMGPVIVGMALSIPVVAL TSLRRTGMALRRAGIFCIPEELDPPKVLVRASELRRAAVLEPSLI
Source in vitro E.coli expression system
Gene Names opgH
Protein Names Recommended name: Glucans biosynthesis glucosyltransferase H EC= 2.4.1.-
Expression Region 1-645
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the biosynthesis of osmoregulated periplasmic glucans (OPGs).
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families Glycosyltransferase 2 family, OpgH subfamily
Database Links

KEGG: xom:XOO3782

Related Products

opgH Proteins

opgH Proteins for Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.