Recombinant Xenopus laevis Protein FAM198B(fam198b)

Code CSB-CF003962XBE
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P86275
Storage Buffer Tris-based buffer,50% glycerol
Species Xenopus laevis (African clawed frog)
Sequence MSPDRTGRGSSSSSSSLKRLVCKSFVRAWGRRRPNLRRAVLLICTASAIYGIVIASQVLR
Source in vitro E.coli expression system
Gene Names fam198b
Protein Names Recommended name: Protein FAM198B Alternative name(s): Expressed in nerve and epithelium during development
Expression Region 1-374
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Golgi apparatus membrane, Single-pass type II membrane protein
Protein Families FAM198 family
Tissue Specificity Low maternal levels detected at the 4-cell stage. At gastrulation, uniformly expressed in the animal cap and marginal zone. During neurulation, expressed in the notochord, underlying gastrocoel roof plate and ventral epidermis. In tailbud embryos, express
Database Links

UniGene: Xl.84664

Related Products

fam198b Proteins

fam198b Proteins for Xenopus laevis (African clawed frog)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.