Recombinant Human Kita-kyushu lung cancer antigen 1 (CT83)-VLPs

In Stock
Code CSB-MP711093HU
Abbreviation Recombinant Human CT83 protein-VLPs
MSDS
Size $620
Order now
Image
  • CSB-MP711093HU is detected by Mouse anti-6*His monoclonal antibody.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
(KK-LC-1)(Cancer/testis antigen 83)
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
1-113aa
Target Protein Sequence
MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
Mol. Weight
14.0 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged(This tag can be tested only under denaturing conditions)
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
PBS, pH 7.4, 6% trehalose
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

CT83, also known as CXorf61 or KK-LC-1, is a small protein of 113 amino acids with unknown function, primarily expressed in mature sperm [1]. However, CT83 is also identified as a tumor antigen expressed in various cancer tissues and testicular germ cells [2]. It is a member of the cancer-testis antigenic protein family and is exclusively expressed in malignant tumor tissue and testicular germ cells [3]. The Human Protein Atlas data revealed that CT83 transcripts were expressed in lung, stomach, colorectal, urothelial, cervix, and breast cancers, as well as in various tumor cell lines [4]. Additionally, CT83, also known as Kita-Kyushu lung cancer antigen-1 (KK-LC-1), has been recognized as a cancer-testis antigen overexpressed in liver cancer [5]. Furthermore, CT83 has been identified as a CTA recognized by cytotoxic T lymphocytes [6]. It is important to note that CT83 does not appear to be expressed by vital human tissues, as it was not detected in a panel of non-neural (except germ cells) and neural tissues [7]. Moreover, CT83 has been suggested as a potential target in lung cancer and has been found to be expressed in 65% of triple-negative breast cancer cases [8].

References:
[1] M. Laisné, S. Benlamara, N. André, L. Djerroudi, N. Gupta, D. Daheret al., "Cancer/testis genes are predictive of breast tumor subtypes",, 2021. https://doi.org/10.1101/2021.10.27.465656
[2] C. Haider, J. Hnat, R. Wagner, H. Huber, G. Timelthaler, M. Grubingeret al., "Transforming growth factor‐β and axl induce cxcl5 and neutrophil recruitment in hepatocellular carcinoma", Hepatology, vol. 69, no. 1, p. 222-236, 2018. https://doi.org/10.1002/hep.30166
[3] J. Chen, A. Wang, G. Lyu, K. Zhou, J. Ke, X. Jiet al., "An innovative prognostic model based on four genes in asian patient with gastric cancer", SSRN Electronic Journal, 2019. https://doi.org/10.2139/ssrn.3391354
[4] Z. Ye, Y. Liang, Y. Ma, B. Lin, L. Cao, B. Wanget al., "Targeted photodynamic therapy of cancer using a novel gallium (iii) tris (ethoxycarbonyl) corrole conjugated‐mab directed against cancer/testis antigens 83", Cancer Medicine, vol. 7, no. 7, p. 3057-3065, 2018. https://doi.org/10.1002/cam4.1601
[5] Z. Chen, X. Zuo, L. Pu, Y. Zhang, G. Han, L. Zhanget al., "Hypomethylation‐mediated activation of cancer/testis antigen kk‐lc‐1 facilitates hepatocellular carcinoma progression through activating the notch1/hes1 signalling", Cell Proliferation, vol. 52, no. 3, 2019. https://doi.org/10.1111/cpr.12581
[6] J. Ji, J. Chen, A. Wang, W. Zhang, H. Ju, Y. Liuet al., "Kk-lc-1 may be an effective prognostic biomarker for gastric cancer",, 2020. https://doi.org/10.21203/rs.3.rs-50773/v2
[7] B. Marcinkowski, S. Stevanović, S. Helman, S. Norberg, C. Serna, B. Jinet al., "Cancer targeting by tcr gene-engineered t cells directed against kita-kyushu lung cancer antigen-1", Journal for Immunotherapy of Cancer, vol. 7, no. 1, 2019. https://doi.org/10.1186/s40425-019-0678-x
[8] R. Lam, T. Tien, C. Joseph, J. Lim, A. Thike, J. Iqbalet al., "Cancer-testis antigens in triple-negative breast cancer: role and potential utility in clinical practice", Cancers, vol. 13, no. 15, p. 3875, 2021. https://doi.org/10.3390/cancers13153875

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

You confirm this protein detected by Western blotting with anti-His? If so, what do you use anti-His?

A:

We use anti-6*His monoclonal antibody as WB to identify the protein, and the code is CSB-MA000011M0m.

Target Background

Gene References into Functions
  1. High KK-LC-1 expression was detected in breast cancer, especially in oestrogen receptor-negative subtypes. PMID: 30275220
  2. The KK-LC-1 expression rate was high even in patients with stage I cancer, suggesting that KK-LC-1 is a useful biomarker for early diagnosis of gastric cancer. PMID: 29290656
  3. KK-LC-1 was frequently expressed in gastric cancer caused by H. pylori infection. PMID: 28438869
  4. CXorf61 is a target for T cell based immunotherapy of triple-negative breast cancer. PMID: 26327325
  5. The frequency of KK-LC-1 expression was higher than that of the other CTAs. KK-LC-1 might be a useful target for immunotherapy and in diagnosis of gastric cancer. PMID: 26026129

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type II membrane protein.
Tissue Specificity
Specifically expressed in testis. Expressed by cancer cell lines.
Database Links

HGNC: 33494

OMIM: 300625

KEGG: hsa:203413

STRING: 9606.ENSP00000360961

UniGene: Hs.97892

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*