Home
Protein
Recombinant Proteins
Recombinant Human Kita-kyushu lung cancer antigen 1 (CT83)

Recombinant Human Kita-kyushu lung cancer antigen 1 (CT83)

^{In Stock}

Code	CSB-EP711093HU
Abbreviation	Recombinant Human CT83 protein
MSDS	MSDS Datasheet
Size	US$256
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP711093HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CT83. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP711093HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CT83.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

CT83

Uniprot No.

Q5H943

Research Area

others

Alternative Names

CT83; CXorf61; KKLC1; Kita-kyushu lung cancer antigen 1; KK-LC-1; Cancer/testis antigen 83

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-113aa

Target Protein Sequence

MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

26.8kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-B2M-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 1-113 constitute the expression domain of recombinant Human CT83. This CT83 protein is expected to have a theoretical molecular weight of 26.8 kDa. This CT83 recombinant protein is manufactured in e.coli. Fusion of the N-terminal 6xHis-B2M tag into the CT83 encoding gene fragment was conducted, allowing for easier detection and purification of the CT83 protein in subsequent stages.

Human kita-Kyushu lung cancer antigen 1 (CT83) is a cancer-testis antigen implicated in tumorigenesis. CT83 is overexpressed in various cancers, particularly lung cancer. Investigation of CT83 provides insights into cancer biology, immunotherapy targets, and potential applications in cancer prognostics, and therapeutic strategies. In cancer research, CT83 is a potential biomarker for prognosis. Its role in immune responses makes it relevant in immunotherapy research. Additionally, CT83's involvement in tumor cell proliferation and survival suggests its contribution to oncogenic processes.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions

High KK-LC-1 expression was detected in breast cancer, especially in oestrogen receptor-negative subtypes. PMID: 30275220
The KK-LC-1 expression rate was high even in patients with stage I cancer, suggesting that KK-LC-1 is a useful biomarker for early diagnosis of gastric cancer. PMID: 29290656
KK-LC-1 was frequently expressed in gastric cancer caused by H. pylori infection. PMID: 28438869
CXorf61 is a target for T cell based immunotherapy of triple-negative breast cancer. PMID: 26327325
The frequency of KK-LC-1 expression was higher than that of the other CTAs. KK-LC-1 might be a useful target for immunotherapy and in diagnosis of gastric cancer. PMID: 26026129

Hide All

Subcellular Location

Cell membrane; Single-pass type II membrane protein.

Tissue Specificity

Specifically expressed in testis. Expressed by cancer cell lines.

Database Links

HGNC: 33494

OMIM: 300625

KEGG: hsa:203413

STRING: 9606.ENSP00000360961

UniGene: Hs.97892

Promotions