Recombinant Candida albicans pH-regulated antigen PRA1 (PRA1)

In Stock
Code CSB-YP308545CZD
Abbreviation Recombinant Candida albicans PRA1 protein
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP308545CZD could indicate that this peptide derived from Yeast-expressed Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) PRA1.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP308545CZD could indicate that this peptide derived from Yeast-expressed Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) PRA1.
  • The purity of PRA1 was greater than 90% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
≥ 90% as determined by SEC-HPLC.
Target Names
PRA1
Uniprot No.
Research Area
Signal Transduction
Alternative Names
PRA1; FBP1; CAALFM_C406980WA; CaO19.10623; CaO19.3111; pH-regulated antigen PRA1; 58 kDa fibrinogen-binding mannoprotein
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Source
Yeast
Expression Region
16-299aa
Target Protein Sequence
APVTVTRFVDASPTGYDWRADWVKGFPIDSSCNATQYNQLSTGLQEAQLLAEHARDHTLRFGSKSPFFRKYFGNETASAEVVGHFDNVVGADKSSILFLCDDLDDKCKNDGWAGYWRGSNHSDQTIICDLSFVTRRYLTQLCSSGYTVSKSKTNIFWAGDLLHRFWHLKSIGQLVIEHYADTYEEVLELAQENSTYAVRNSNSLIYYALDVYAYDVTIPGEGCNGDGTSYKKSDFSSFEDSDSGSDSGASSTASSSHQHTDSNPSATTDANSHCHTHADGEVHC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
33.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Candida albicans pH-regulated antigen PRA1 is produced using a yeast expression system, covering amino acids 16-299 of the mature protein. The full-length protein includes an N-terminal 6xHis tag to simplify purification and detection. SDS-PAGE analysis confirms the product achieves greater than 90% purity, which appears to ensure reliable performance in research applications. Endotoxin levels are kept low to support consistent experimental outcomes.

PRA1, a pH-regulated antigen from Candida albicans, seems to play a significant role in the organism's virulence and adaptability. The protein is involved in how this fungal pathogen responds to environmental pH changes, affecting its ability to survive and persist in different conditions. Understanding PRA1's function may be crucial for research into fungal pathogenesis and host-pathogen interactions. This makes it an important target in studies of Candida infections, though the exact mechanisms remain an active area of investigation.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant Candida albicans PRA1 protein is expressed in a Yeast expression system, which is phylogenetically similar to Candida albicans (both are fungi), increasing the likelihood of proper folding and post-translational modifications. The high purity (>90% by SDS-PAGE and SEC-HPLC) suggests a homogeneous preparation, and SEC-HPLC results indicate the protein is likely monodisperse, which often correlates with correct folding. However, since activity is unverified, the protein cannot be guaranteed to be correctly folded or bioactive without functional validation (e.g., binding assays or immunological activity tests). While the expression system supports a high probability of correct folding, experimental confirmation is essential.

1. Antigen-Antibody Interaction Studies

This recombinant PRA1 protein can function as an antigen for developing and characterizing antibodies against Candida albicans. The N-terminal 6xHis tag allows for straightforward immobilization on nickel-coated surfaces during ELISA-based antibody screening and binding affinity measurements. With >90% purity, the protein likely provides reliable and reproducible results in antibody development workflows. Researchers might use this protein to evaluate cross-reactivity patterns and the specificity of anti-Candida antibodies in controlled in vitro assays. However, if the protein is misfolded, antibodies generated may not recognize conformational epitopes of the native PRA1 protein in its physiological context, so validation against native PRA1 is recommended.

2. Protein-Protein Interaction Analysis

The 6xHis tag makes pull-down experiments technically feasible for identifying potential binding partners of PRA1 from Candida albicans cell lysates or other protein mixtures. The recombinant protein can be immobilized on nickel affinity resins to capture interacting proteins. However, if PRA1 is misfolded, it may not interact physiologically with true binding partners, leading to non-specific or false interactions. The high purity level should minimize background binding, but results should be interpreted cautiously until folding is validated through functional assays. If correctly folded, this application is valuable; otherwise, it may yield misleading data.

3. Biochemical Characterization and Stability Studies

The purified recombinant PRA1 protein allows for comprehensive biochemical analysis, including determination of molecular weight, isoelectric point, and thermal stability profiles. Researchers can investigate how the protein behaves under various pH conditions—particularly relevant given its designation as a pH-regulated antigen. The yeast expression system likely ensures proper eukaryotic folding, making it suitable for studying native-like biochemical properties. These studies can directly assess folding status (e.g., via circular dichroism or SEC-HPLC) and are valuable even if the protein is misfolded, as they characterize the recombinant product. The description is correct.

4. Immunological Research Applications

This recombinant PRA1 can be used to study immune responses in cell culture models by exposing immune cells to the purified antigen and measuring cytokine production or cellular activation markers. The protein serves as a standardized antigen for investigating host-pathogen interactions. However, if misfolded, conformational epitopes may be altered, potentially leading to non-physiological immune responses. The high purity supports reproducibility, but researchers should validate findings using native PRA1 or in vivo models to ensure relevance. The description is generally correct but requires caution for interpretation.

Final Recommendation & Action Plan

Given the high probability of correct folding due to the homologous yeast expression system and high purity, but without activity verification, it is recommended to first perform biochemical and functional validation to confirm protein folding and bioactivity. Prioritize applications like biochemical characterization and antibody development, which are less dependent on native conformation, while postponing protein-protein interaction studies until folding is confirmed. Use techniques such as circular dichroism for secondary structure analysis and functional assays (e.g., binding to known partners or antibodies) to validate activity. If the protein is active, it can be reliably used for all described applications; if not, focus on non-functional uses like antigen production or stability studies. Always include controls with native PRA1 when possible to ensure physiological relevance.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cell surface protein involved in the host-parasite interaction during candidal infection. With MP65, represents a major component of the biofilm matrix. Sequesters zinc from host tissue and mediates leukocyte adhesion and migration. As a surface protein, binds the two human complement regulators CFH and CFHR1, as well as plasminogen PLG, mediates complement evasion and extra-cellular matrix interaction and/or degradation. As a released protein, enhances complement control in direct vicinity of the yeast and thus generates an additional protective layer which controls host complement attack, assisting the fungus in escaping host surveillance. Binds to host fluid-phase C3 and blocks cleavage of C3 to C3a and C3b, leading to inhibition of complement activation. Mediates also human complement control and complement evasion through binding to C4BPA, another human complement inhibitor, as well as through binding to host integrin alpha-M/beta-2. Decreases complement-mediated adhesion, as well as uptake of C.albicans by human macrophages.
Gene References into Functions
  1. Pra1 is a hierarchical complement inhibitor that targets C3 by cleaving C3 at a unique site. This inhibited effector function of the activation fragments. Pra1 also bound to C3a and C3b generated by human convertases and blocked their effector functions, C3a binding to human C3a receptor, calcium signaling, IL-8 release, C3b deposition, opsonophagocytosis, and killing by neutrophils. PMID: 28860090
  2. surface-exposed Pra1 plays a role in the recognition of Candida albicans, especially hyphal cells, by human neutrophils PMID: 21820180
  3. recognition of pH-regulated antigen 1 protein (Pra1p) by integrin alpha(M)betaplays a pivotal role in determining fungal virulence and host response and protection against C. albicans infection PMID: 21245270
  4. Data show that the fungus secretes a potent complement inhibitor, pH-regulated Ag 1 (Pra1), which in the direct surrounding of the pathogen binds to fluid-phase C3 and blocks cleavage of C3 to C3a and C3b. PMID: 20644161
  5. Therefore, it appears that Pra1p can play at most a minor role in fibrinogen binding to C. albicans. PMID: 18625733
  6. The pH-regulated antigen 1 (Pra1) protein was identified as a novel Factor H and FHL-1 binding protein. PMID: 19850343

Show More

Hide All

Subcellular Location
Secreted. Note=Found primarily on the cell surface of filamentous forms and enriched at hyphal tips.
Protein Families
ZPS1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*