Recombinant Escherichia coli Outer membrane protein assembly factor BamA(BamA),partial

In Stock
Code CSB-EP364271ENV1
Product Type Recombinant Protein
Size US$2466
Uniprot No. P0A940
Lead Time 3-7 business days
Storage Buffer Tris-based buffer,50% glycerol
Species Escherichia coli (strain K12)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERNTG
Research Area Others
Source E.coli
Gene Names bamA
Expression Region 175-424aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 36.0 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Part of the outer membrane protein assembly complex (Bam), which is involved in assembly and insertion of beta-barrel proteins into the outer membrane. Constitutes, with BamD, the core component of the assembly machinery. Efficient substrate folding and insertion into the outer membrane requires all 5 subunits
Subcellular Location Cell outer membrane
Protein Families BamA family
Database Links

KEGG: ecj:JW0172

STRING: 316385.ECDH10B_0157

Related Products

bamA Antibodies

bamA Antibodies for Escherichia coli (strain K12)

bamA Proteins

bamA Proteins for Escherichia coli (strain K12)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.