Recombinant Human Glutamyl aminopeptidase (ENPEP), partial

Code CSB-RP147594h(c)
Abbreviation Recombinant Human ENPEP protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Aminopeptidase A; AMPE_HUMAN; AP-A; APA; bp-1; bp1; CD249; Differentiation antigen gp160; EAP; Enpep; Glutamyl aminopeptidase (aminopeptidase A); Glutamyl aminopeptidase; Gp160; Ly51
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
719-949aa
Target Protein Sequence
YFQGQVKPIADSLGWNDAGDHVTKLLRSSVLGFACKMGDREALNNASSLFEQWLNGTVSLPVNLRLLVYRYGMQNSGNEISWNYTLEQYQKTSLAQEKEKLLYGLASVKNVTLLSRYLDLLKDTNLIKTQDVFTVIRYISYNSYGKNMAWNWIQLNWDYLVNRYTLNNRNLGRIVTIAEPFNTELQLWQMESFFAKYPQAGAGEKPREQVLETVKNNIEWLKQHRNTIREW
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.0kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Could you provide the following information about CSB-RP147594h(c)?
1) Buffer formulation
2) Preservative/Concentration
3) Supplied Form (Liquid or Lyophilized)

A:
Very nice to receive your inquiry.
1) Our default buffer is as below: 20mM Tris-HCl, 0.5M NaCl, pH 8.0, 50% glycerol. If you have special requirement for storage buffer, please kindly communicate with us in advance.
2) There contains NO Preservative.
3) Our default delivery form is Liquid. If you need Lyophilized Powder, please kindly communicate with us in advance.

Target Background

Function
Regulates central hypertension through its calcium-modulated preference to cleave N-terminal acidic residues from peptides such as angiotensin II.
Gene References into Functions
  1. We suggest that APA enzymatic activity affects tumor initiation and cancer malignancy in a TWIST-dependent manner PMID: 28177885
  2. The substrate Angiotensin II, the enzymes aminopeptidases-A, B, M as well as IRAP were detected in the jejunal mucosa. PMID: 26311161
  3. This study suggests a role for GAP in the neoplastic development of renal tumours and provides additional data for considering the activity and expression of this enzyme of interest in the diagnosis and prognosis of renal neoplasms. PMID: 24885240
  4. These results explain the calcium-modulated substrate specificity of APA in central hypertension regulation PMID: 23888046
  5. There was no significant alteration in plasma APA activity in the patients with Chagas disease or dilated cardiomyopathies, as compared with that in health controls PMID: 21697726
  6. Rieger syndrome with microdeletions including only the PITX2 and ENPEP (glutamyl aminopeptidase) genes. PMID: 17850355
  7. Data show that APA appears to be an essential enzyme in the control of blood pressure via degradation of Angiotensin II. PMID: 17990103
  8. Data show that aminopeptidase A (APA) plays important roles in the regulation of blood pressure under both the physiological and pathological conditions. PMID: 17999179
  9. Data show that brain aminopeptidases act upon Ang I, Ang II and Ang III in order to activate brain AT(1) receptors. PMID: 18188697
  10. rare and common variation in ENPEP may contribute to the development of renal and hypertensive disorders and warrants further study PMID: 18206321
  11. The presence of APA in several human brain nuclei sensitive to angiotensins and involved in blood pressure regulation suggests that APA in humans is an integral component of the brain renin angiotensin system. PMID: 18410507
  12. A novel nonsense polymorphism in the aminopeptidase-a gene was associated with hypertension among postmenopausal women, and those with marginal calcium and vitamin D intake. PMID: 18550936
  13. Angiotensin III and aminopeptidase A and N, related converting enzymes, contribute to cell proliferation of prostate cancer and may be implicated in cancer progression. PMID: 18677709
  14. Over-expressed APA drastically reduces, in a calcium dependent manner, full-length-Abeta but not amyloid-beta precursor protein (APP) intracellular domain in a cell-free model of Abeta production. PMID: 19187443
  15. The activity of glutamyl aminopeptidase was significally increased in head and neck squamous cell carcinoma tissue. PMID: 19373777

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type II membrane protein.
Protein Families
Peptidase M1 family
Tissue Specificity
Expressed in choriocarcinoma cancer cell lines (at protein level). Expressed by epithelial cells of the proximal tubule cells and the glomerulus of the nephron. Also found in a variety of other tissues.
Database Links

HGNC: 3355

OMIM: 138297

KEGG: hsa:2028

STRING: 9606.ENSP00000265162

UniGene: Hs.435765

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*