Name: Recombinant Human Glutamyl aminopeptidase (ENPEP), partial
Brand: CUSABIO
SKU: CSB-RP147594h(c)

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

ENPEP

Uniprot No.

Q07075

Research Area

Immunology

Alternative Names

Aminopeptidase A; AMPE_HUMAN; AP-A; APA; bp-1; bp1; CD249; Differentiation antigen gp160; EAP; Enpep; Glutamyl aminopeptidase (aminopeptidase A); Glutamyl aminopeptidase; Gp160; Ly51

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

719-949aa

Target Protein Sequence

YFQGQVKPIADSLGWNDAGDHVTKLLRSSVLGFACKMGDREALNNASSLFEQWLNGTVSLPVNLRLLVYRYGMQNSGNEISWNYTLEQYQKTSLAQEKEKLLYGLASVKNVTLLSRYLDLLKDTNLIKTQDVFTVIRYISYNSYGKNMAWNWIQLNWDYLVNRYTLNNRNLGRIVTIAEPFNTELQLWQMESFFAKYPQAGAGEKPREQVLETVKNNIEWLKQHRNTIREW
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

31.0kDa

Protein Length

Extracellular Domain

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Related Products

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

Could you provide the following information about CSB-RP147594h(c)?
1) Buffer formulation
2) Preservative/Concentration
3) Supplied Form (Liquid or Lyophilized)

Very nice to receive your inquiry.
1) Our default buffer is as below: 20mM Tris-HCl, 0.5M NaCl, pH 8.0, 50% glycerol. If you have special requirement for storage buffer, please kindly communicate with us in advance.
2) There contains NO Preservative.
3) Our default delivery form is Liquid. If you need Lyophilized Powder, please kindly communicate with us in advance.

Target Background

Function

Regulates central hypertension through its calcium-modulated preference to cleave N-terminal acidic residues from peptides such as angiotensin II.

Gene References into Functions

We suggest that APA enzymatic activity affects tumor initiation and cancer malignancy in a TWIST-dependent manner PMID: 28177885
The substrate Angiotensin II, the enzymes aminopeptidases-A, B, M as well as IRAP were detected in the jejunal mucosa. PMID: 26311161
This study suggests a role for GAP in the neoplastic development of renal tumours and provides additional data for considering the activity and expression of this enzyme of interest in the diagnosis and prognosis of renal neoplasms. PMID: 24885240
These results explain the calcium-modulated substrate specificity of APA in central hypertension regulation PMID: 23888046
There was no significant alteration in plasma APA activity in the patients with Chagas disease or dilated cardiomyopathies, as compared with that in health controls PMID: 21697726
Rieger syndrome with microdeletions including only the PITX2 and ENPEP (glutamyl aminopeptidase) genes. PMID: 17850355
Data show that APA appears to be an essential enzyme in the control of blood pressure via degradation of Angiotensin II. PMID: 17990103
Data show that aminopeptidase A (APA) plays important roles in the regulation of blood pressure under both the physiological and pathological conditions. PMID: 17999179
Data show that brain aminopeptidases act upon Ang I, Ang II and Ang III in order to activate brain AT(1) receptors. PMID: 18188697
rare and common variation in ENPEP may contribute to the development of renal and hypertensive disorders and warrants further study PMID: 18206321
The presence of APA in several human brain nuclei sensitive to angiotensins and involved in blood pressure regulation suggests that APA in humans is an integral component of the brain renin angiotensin system. PMID: 18410507
A novel nonsense polymorphism in the aminopeptidase-a gene was associated with hypertension among postmenopausal women, and those with marginal calcium and vitamin D intake. PMID: 18550936
Angiotensin III and aminopeptidase A and N, related converting enzymes, contribute to cell proliferation of prostate cancer and may be implicated in cancer progression. PMID: 18677709
Over-expressed APA drastically reduces, in a calcium dependent manner, full-length-Abeta but not amyloid-beta precursor protein (APP) intracellular domain in a cell-free model of Abeta production. PMID: 19187443
The activity of glutamyl aminopeptidase was significally increased in head and neck squamous cell carcinoma tissue. PMID: 19373777

Hide All

Subcellular Location

Cell membrane; Single-pass type II membrane protein.

Protein Families

Peptidase M1 family

Tissue Specificity

Expressed in choriocarcinoma cancer cell lines (at protein level). Expressed by epithelial cells of the proximal tubule cells and the glomerulus of the nephron. Also found in a variety of other tissues.

Database Links

HGNC: 3355

OMIM: 138297

KEGG: hsa:2028

STRING: 9606.ENSP00000265162

UniGene: Hs.435765

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address