Recombinant Human AFG3-like protein 2(AFG3L2),partial

Code CSB-RP040044h
Product Type Recombinant Protein
Size US$1726
Uniprot No. Q9Y4W6
Relevance ATP-dependent protease which is essential for axonal development.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Paraplegin-like protein
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence ERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVAGWYLEHADPLLKVSIIPRGKGLGYAQYLPKEQYLYTKEQLLDRMCMTLGGRVSEEIFFGRITTGAQDDLRKVTQSAYAQIVQFGMNEKVGQISFDLPRQGDMVLEKPYSEATARLIDDEVRILINDAYKRTVALLTEKKADVEKVALLLLEKEVLDKNDMVELLGPRPFAEKSTYEEF
Research Area Metabolism
Protocol
Protocol may be improved. Please feel free to contact CUSABIO product specialist to obtain the latest version.
Source E.coli
Gene Names AFG3L2
Expression Region 550-759aa
Tag Info N-terminal GST-tagged
Mol. Weight 50.8kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function ATP-dependent protease which is essential for axonal and neuron development. In neurons, mediates degradation of SMDT1/EMRE before its assembly with the uniporter complex, limiting the availability of SMDT1/EMRE for MCU assembly and promoting efficient assembly of gatekeeper subunits with MCU
Involvement in disease Spinocerebellar ataxia 28 (SCA28); Spastic ataxia 5, autosomal recessive (SPAX5)
Subcellular Location Mitochondrion, Mitochondrion inner membrane, Multi-pass membrane protein
Protein Families AAA ATPase family; Peptidase M41 family
Tissue Specificity Ubiquitous. Highly expressed in the cerebellar Purkinje cells.
Database Links

HGNC: 315

OMIM: 604581

KEGG: hsa:10939

STRING: 9606.ENSP00000269143

UniGene: Hs.726355

Related Products

AFG3L2 Antibodies

AFG3L2 Antibodies for Human

AFG3L2 Antibodies for Homo sapiens (Human)

AFG3L2 Proteins

AFG3L2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.