Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Signal Transduction
Alternative Names
17 beta HSD 5; 17 beta hydroxysteroid dehydrogenase type 5; 17-beta-HSD 5; 17-beta-hydroxysteroid dehydrogenase type 5; 2-dihydrobenzene-1; 2-diol dehydrogenase; 20 alpha-hydroxysteroid dehydrogenase; 20-alpha-hydroxysteroid dehydrogenase; 3 alpha hydroxysteroid dehydrogenase type II; 3-alpha-HSD type 2; 3-alpha-HSD type II; 3-alpha-HSD type II; brain; 3-alpha-hydroxysteroid dehydrogenase type 2; AK1C3_HUMAN; AKR1 C3; Akr1c18; AKR1C3; Aldo keto reductase family 1 member C3; Aldo-keto reductase family 1 member C3; brain; Chlordecone reductase; Chlordecone reductase homolog HAKRb; DD-3; DD3; DDH1; DDX; Dihydrodiol dehydrogenase 3; Dihydrodiol dehydrogenase type I; Dihydrodiol dehydrogenase X; HA1753; HAKRB; HAKRe; hluPGFS; HSD17B5; Indanol dehydrogenase; KIAA0119; PGFS; Prostaglandin F synthase; Testosterone 17-beta-dehydrogenase 5; Trans-1; Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; Type IIb 3 alpha hydroxysteroid dehydrogenase
Species
Homo sapiens (Human)
Expression Region
1-323aa
Target Protein Sequence
MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Insertion of the gene encoding the Human AKR1C3 protein (1-323aa) into a plasmid vector results in the formation of recombinant plasmid, which is then introduced into e.coli cells. Positive e.coli cells are selected relying on their ability to survive in the presence of a specific antibiotic. The e.coli cells containing the recombinant plasmid are cultured under conditions conducive to the expression of the gene of interest. A N-terminal GST tag is attached to the protein. Following expression, the recombinant Human AKR1C3 protein is isolated and purified from the cell lysate through affinity purification. The resultant recombinant Human AKR1C3 protein is analyzed using denaturing SDS-PAGE, revealing a purity greater than 90%.