Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-EP001544HU |
| Product Type | Recombinant Protein |
| Size | US$1726 |
| Uniprot No. | P42330 |
| Relevance | Catalyzes the conversion of aldehydes and ketones to alcohols. Catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ) and the oxidation of 9-alpha,11-beta-PGF2 to PGD2. Functions as a bi-directional 3-alpha-, 17-beta- and 20-alpha HSD. Can interconvert active androgens, estrogens and progestins with their cognate inactive metabolites. Preferentially transforms androstenedione (4-dione) to testosterone. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | 17-beta-hydroxysteroid dehydrogenase type 5 |
| Species | Homo sapiens (Human) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY |
| Research Area | Signal Transduction |
| Source | E.coli |
| Gene Names | AKR1C3 |
| Protein Names | Recommended name: Aldo-keto reductase family 1 member C3 EC= 1.-.-.- Alternative name(s): 17-beta-hydroxysteroid dehydrogenase type 5 Short name= 17-beta-HSD 5 3-alpha-HSD type II, brain 3-alpha-hydroxysteroid dehydrogenase t |
| Expression Region | 1-323aa |
| Tag Info | N-terminal GST-tagged |
| Mol. Weight | 63.9kDa |
| Protein Description | Full Length |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Catalyzes the conversion of aldehydes and ketones to alcohols. Catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ) and the oxidation of 9-alpha,11-beta-PGF2 to PGD2. Functions as a bi-directional 3-alpha-, 17-beta- and 20-alpha HSD. Can interconvert active androgens, estrogens and progestins with their cognate inactive metabolites. Preferentially transforms androstenedione (4-dione) to testosterone. |
| Subcellular Location | Cytoplasm |
| Protein Families | Aldo/keto reductase family |
| Tissue Specificity | Expressed in many tissues including adrenal gland, brain, kidney, liver, lung, mammary gland, placenta, small intestine, colon, spleen, prostate and testis. The dominant HSD in prostate and mammary gland. In the prostate, higher levels in epithelial cells |
| Database Links |
HGNC: 386 OMIM: 603966 KEGG: hsa:8644 STRING: 9606.ENSP00000369927 UniGene: Hs.78183 |
AKR1C3 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA001544GA01HU | AKR1C3 Antibody | Human | ELISA,WB,IHC |
| CSB-PA070113 | AKR1C3 Antibody | Human | WB,ELISA |
AKR1C3 Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA001544ESR1HU | AKR1C3 Antibody | Human | ELISA, WB, IHC, IP |
AKR1C3 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP001544HU CSB-BP001544HU CSB-MP001544HU |
Recombinant Human Aldo-keto reductase family 1 member C3(AKR1C3) | Yeast Baculovirus Mammalian cell |
Recombinant Human High affinity immunoglobulin epsilon receptor subunit gamma(FCER1G),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Mouse Nuclease-sensitive element-binding protein 1(Ybx1)
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Mouse Glucose-6-phosphate isomerase(Gpi)
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Human Bcl-2-like protein 11(BCL2L11)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Mouse Telomerase reverse transcriptase(Tert),partial
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human Tubulin polymerization-promoting protein(TPPP)
Express system: E.coli
Species: Homo sapiens (Human)
