Recombinant Human Anoctamin-1 (ANO1), partial

In Stock Promotion
Code CSB-EP713621HU2
Abbreviation Recombinant Human ANO1 protein, partial
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
ANO1
Uniprot No.
Research Area
Tags & Cell Markers
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
806-892aa
Target Protein Sequence
SFTSDFIPRLVYLYMYSKNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKYDISKDFWAVLAARLA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
17.6 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Calcium-activated chloride channel (CaCC) which plays a role in transepithelial anion transport and smooth muscle contraction. Required for the normal functioning of the interstitial cells of Cajal (ICCs) which generate electrical pacemaker activity in gastrointestinal smooth muscles. Acts as a major contributor to basal and stimulated chloride conductance in airway epithelial cells and plays an important role in tracheal cartilage development.
Gene References into Functions
  1. Bile acids stimulate Cl(-) secretion in biliary cells through activation of membrane TMEM16A channels in a process regulated by extracellular ATP and [Ca(2+) ]i . PMID: 29360145
  2. This will include discussion of developed knockout models that have provided much needed insight on the functional localization of TMEM16A in several epithelial tissues. Finally, this review will examine the implications of the identification of TMEM16A as it pertains to potential novel therapies in several pathologies PMID: 29748496
  3. Inhibition of STAT6/Anoctamin-1 activation decreased proliferation, migration, or invasion of gastric cancer cells. PMID: 29466035
  4. The effect of CLCA2 on ICaCC (calcium-activated chloride channel currents) was tested in HEK293 cells stably expressing calcium-activated chloride channel TMEM16A. PMID: 29758025
  5. TMEM16A expression was found to correlate with greater tumor size, less Bim expression, and less apoptotic activity overall in head and neck squamous cell carcinomas (HNSCCs). PMID: 28899969
  6. resveratrol (RES) might be a promising drug for the treatment of gastrointestinal hypomotility. As RES was able to induce TMEM16A channel activation, TMEM16A can be added to the list of RES drug targets. PMID: 28852814
  7. results indicate that the enhanced activity in chimeric channels is due to altered interaction between the carboxy-terminus and the first intracellular loop in the TMEM16A homo-dimer. Mimicking this perturbation with a small molecule could be the basis for a pharmacological stimulation of TMEM16A-dependent Cl(-) transport. PMID: 27929144
  8. ANO1 overexpression associated with the high expression of EGFR can be a predictive marker of recurrence after surgery in non-small cell lung cancer PMID: 28299581
  9. Study demonstrated that segment a is a critical domain for the surface expression of ANO1, and identified 14-3-3gamma as a binding partner for this segment enhancing the surface expression of ANO1. In addition, gene silencing of 14-3-3gamma and/or ANO1 inhibited migration and invasion of these glioblastoma cell lines. PMID: 27212225
  10. lipids and fatty acids regulate TMEM16A channels through a membrane-delimited protein-lipid interaction. PMID: 29277655
  11. knockdown of ESYT1 (and family members ESYT2 and ESYT3) significantly decreased ANO1 current density. PMID: 29154949
  12. labeled proteins were imaged and showed that hTMEM16A resides in the plasma membrane as dimer only and is not present as monomer. PMID: 28559167
  13. ANO1 overexpression promotes cancer cell proliferation and migration. Genetic or pharmacological inhibition of ANO1 induces apoptosis and cell cycle arrest at G1 phase in different types of epithelium-originated cancer cells. PMID: 27732935
  14. Furthermore, the overexpression of ANO1 has a significant effect on both distant metastasis and poor prognosis. Our results suggest a potential role for ANO1 in CRC through miR-132. PMID: 26868958
  15. Data show that ANO1 in peripheral blood is of clinical potential for monitoring recurrence and evaluating therapeutic efficacy of imatinib for GIST patients. PMID: 27153560
  16. Results show that TMEM16A is a direct target of miR-381 and its expression in gastric neoplasm is inversely correlated to that of miR-381.TMEM16A mediates the functional effects of miR-381 on migration and invasion in gastric cancer cells. PMID: 28193228
  17. Positive anoctamin 1 (ANO1) is a promising biomarker to predict the unfavorable outcome for ESCC patients and disease progression of precancerous lesions. PMID: 27016410
  18. TMEM16A expression was enhanced by 24-h treatment of IL-4 in human nasal epithelial cells. PMID: 28546154
  19. findings demonstrate that Ca2+ influx via store-operated CRAC channels is essential for CaCC activation, chloride secretion, and sweat production in humans and mice. PMID: 27721237
  20. TMEM16A activation as a sequential, direct, and Vm-dependent binding. PMID: 27138167
  21. Ano1(0) without EAVK [Ano1(0)DeltaEAVK] has reduced sensitivity for intracellular calcium, attributable to slower kinetics. Differential expression of EAVK may function as a calcium-sensitive switch in the human stomach. PMID: 28336549
  22. Gains of ANO1 is associated with oropharyngeal squamous cell carcinoma. PMID: 27750372
  23. DOG1 is a novel marker for identifying intercellular canaliculi and is a potential immunomarker of myoepithelial cells specific to mammary glands, anogenital mammary-like glands and tumors originating therein. PMID: 27506854
  24. Increase in TMEM16A activity occurred within minutes of exposure to CLCA1 or after a short treatment with nocodazole, consistent with the hypothesis that CLCA1 stabilizes TMEM16A at the cell surface by preventing its internalization. PMID: 28420732
  25. These results suggest that ANO1 Cl(-) channels may function as a transcriptional regulator of HER2, and ANO1 inhibitors have potential in the treatment of BCA patients with resistance to HER2-targeted therapy. PMID: 27838298
  26. Endogenous ANO1 was associated with COPB1 in U251 glioblastoma cells, and silencing of COPB1 enhanced surface expression and whole-cell currents of ANO1 in these cells. Taken together, these data suggest that COPB1 negatively regulates ANO1 surface expression. PMID: 27207835
  27. targeting TMEM16A improves response to biological therapies targeting EGFR/HER family members PMID: 28177558
  28. STAT6-TMEM16A-ERK1/2 signal pathway and TMEM16A channel activity are required for the IL-13-induced TMEM16A mediated mucus production PMID: 27588910
  29. DOG1 positivity was detected in most gastrointestinal stromal tumors and its overexpression was related with adverse prognosis PMID: 28044310
  30. DOG1 positivity might be a candidate marker to support KIT and PDGFRA mutations. PMID: 27178821
  31. Results showed that DOG1 expression was consistently positive in breast myoepithelial cells (MEC), and is then a useful MEC marker providing more sophisticated information when diagnosing uncertain cases in the breast. PMID: 27041791
  32. ANO1 on ICCs makes a key contribution to generation and regulation of pacemaker electrical slow-wave activity. PMID: 26510736
  33. Data show that calcium-activated chloride channel TMEM16 overexpression correlates with decreased survival in human papilloma virus -negative tumors. PMID: 26563938
  34. DOG1 was expressed in 66% of CD117(+) GISTs and highly associated with tumor size and the rate of wild-type tumors PMID: 26867653
  35. DOG1 positivity in select non-GIST tumors. PMID: 26678977
  36. Our results indicated that both the electrical property and the size of the side-chain at residue 447 have significant effects on Ca(2+) dependent gating of TMEM16A. PMID: 26481648
  37. ANO1 expression and gene amplification showed no significant associations with clinicopathological parameters in HNSCC. PMID: 26498851
  38. DOG1 is a sensitive marker in the diagnosis of acinic cell carcinoma PMID: 26464669
  39. TCGA analysis showed that ANO1 and FADD, located at 11q13, were co-expressed at transcript level and significantly associated with overall and disease-free survival PMID: 26808319
  40. Aberrant c-KIT and DOG-1 expressions in CRC are rare events, either in NMA or MA. PMID: 26272691
  41. Anoctamin and pendrin are two plausible candidates as mediators of apical iodide efflux--{review} PMID: 26313899
  42. our findings provide evidence that ANO1 overexpression contributes to tumor growth and invasion of lung cancer; and suppressing ANO1 overexpression may have therapeutic potential in lung cancer therapy PMID: 26305547
  43. DOG1 expression was found in low-grade fibromyxoid sarcoma, highlighting the potential for diagnostic confusion with gastrointestinal stromal tumors. PMID: 26135531
  44. DOG-1, VEGFA and p16 are expressed in cutaneous basal and squamous cell carcinomas PMID: 26429157
  45. PKCalpha is coupled to ATP-stimulated TMEM16A activation in biliary epithelial cells. PMID: 26542395
  46. gastrointestinal stromal tumors with mutations in the DOG1 gene were not found PMID: 26191287
  47. Pancreatic ductal adenocarcinoma cell lines showed an upregulation of ANO1 on mRNA and protein levels. ANO1 is the main constituent of CaCC current in PDAC cells. PMID: 25163766
  48. TMEM16A overexpression promotes invasion and metastasis in gastric cancer. PMID: 25839162
  49. ANO1 and EGFR form a functional complex that jointly regulates head & neck squamous cell carcinoma cell proliferation. PMID: 25823819
  50. examined TMEM16A protein interactions with calmodulin and CaMKIIdelta likely cause efflux of chloride, thus resulting in increased vascular resistance by increasing vascular wall tone in long-standing hypertension PMID: 25914185

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasm.
Protein Families
Anoctamin family
Tissue Specificity
Broadly expressed with higher levels in liver, skeletal muscle and gastrointestinal muscles.
Database Links

HGNC: 21625

OMIM: 610108

KEGG: hsa:55107

STRING: 9606.ENSP00000347454

UniGene: Hs.503074

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*