| Code | CSB-EP001933HU |
| Size |
$1812Purchase it in Cusabio online store (only available for customers from the US) |
| Image |
|
| Have Questions? | Leave a Message or Start an on-line Chat |
| Description |
The N-terminal 6xHis-SUMO tag was fused to the gene fragment corresponding to the 21-99aa of the human APOC3 protein and then was cloned into an expression vector. The expression vector was transformed into the E.coli for expression. The generated product was purified and separated to obtain the recombinant human APOC3 protein. Its purity is higher than 90%. This recombinant human APOC3 protein showed an apparent molecular weight of about 23 kDa under SDS-PAGE condition. APOC3 is a gene encoding a protein named Apolipoprotein C-III and belongs apolipoprotein C3 family. This protein is secreted by the liver as well as the small intestine, and is a protein component of triglyceride (TG)-rich lipoproteins (TRLs) including very low density lipoproteins (VLDL), high density lipoproteins (HDL) and chylomicrons. it plays a role in role in the metabolism of these TRLs through multiple modes. Diseases associated with APOC3 include Apolipoprotein C-Iii Deficiency and Hyperalphalipoproteinemia. Additionally, APOC3 is a novel inducer of calcification in human aortic valves. Higher ANGPTL3, apoC-III, and apoB48 dyslipidemia, and lower lipoprotein lipase concentrations are associated with dysfunctional visceral fat in adolescents with obesity. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Target Names | APOC3 |
| Uniprot No. | P02656 |
| Research Area | Metabolism |
| Alternative Names | APOC3; APO C3; Apo CIII; Apo-CIII; APOC 3; ApoC III; ApoC-III; APOC3; APOC3_HUMAN; ApoCIII; Apolipoprotein C III; Apolipoprotein C-III; Apolipoprotein C3; ApolipoproteinCIII; MGC150353 |
| Species | Homo sapiens (Human) |
| Source | E.coli |
| Expression Region | 21-99aa |
| Target Protein Sequence | SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 24.8kDa |
| Protein Length | Full Length of Mature Protein |
| Tag Info |
N-terminal 6xHis-SUMO-tagged |
| Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | 3-7 business days |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
| Function |
Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors. Formed of several curved helices connected via semiflexible hinges, so that it can wrap tightly around the curved micelle surface and easily adapt to the different diameters of its natural binding partners.
|
| Gene References into Functions |
|
| Involvement in disease | Hyperalphalipoproteinemia 2 (HALP2) |
| Subcellular Location | Secreted. |
| Protein Families | Apolipoprotein C3 family |
| Tissue Specificity | Liver. |
| Database Links |
HGNC: 610 OMIM: 107720 KEGG: hsa:345 STRING: 9606.ENSP00000227667 UniGene: Hs.73849 |
