Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
APOC3; APO C3; Apo CIII; Apo-CIII; APOC 3; ApoC III; ApoC-III; APOC3; APOC3_HUMAN; ApoCIII; Apolipoprotein C III; Apolipoprotein C-III; Apolipoprotein C3; ApolipoproteinCIII; MGC150353
Species
Homo sapiens (Human)
Expression Region
21-99aa
Target Protein Sequence
SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The N-terminal 6xHis-SUMO tag was fused to the gene fragment corresponding to the 21-99aa of the human APOC3 protein and then was cloned into an expression vector. The expression vector was transformed into the E.coli for expression. The generated product was purified and separated to obtain the recombinant human APOC3 protein. Its purity is higher than 90%. This recombinant human APOC3 protein showed an apparent molecular weight of about 23 kDa under SDS-PAGE condition.
APOC3 is a gene encoding a protein named Apolipoprotein C-III and belongs apolipoprotein C3 family. This protein is secreted by the liver as well as the small intestine, and is a protein component of triglyceride (TG)-rich lipoproteins (TRLs) including very low density lipoproteins (VLDL), high density lipoproteins (HDL) and chylomicrons. it plays a role in role in the metabolism of these TRLs through multiple modes. Diseases associated with APOC3 include Apolipoprotein C-Iii Deficiency and Hyperalphalipoproteinemia. Additionally, APOC3 is a novel inducer of calcification in human aortic valves. Higher ANGPTL3, apoC-III, and apoB48 dyslipidemia, and lower lipoprotein lipase concentrations are associated with dysfunctional visceral fat in adolescents with obesity.