Recombinant Human Collagen alpha-1(XI) chain,partial

Code CSB-YP005716HU
Product Type Recombinant Protein
Size US$2959
Uniprot No. P12107
Relevance May play an important role in fibrillogenesis by controlling lateral growth of collagen II fibrils.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence GPMGLTGRPGPVGGPGSSGAKGESGDPGPQGPRGVQGPPGPTGKPGKRGRPGADGGRGMPGEPGAKGDRGFDGLPGLPGDKGHRGERGPQGPPGPPGDDGMRGEDGEIGPRGLPGEAGPRGLLGPRGTPGAPGQPGMAGVDGPPGPKGNMGPQGEPGPPGQQGNPGPQ
Source Yeast
Gene Names COL11A1
Protein Names Recommended name: Collagen alpha-1(XI) chain
Expression Region 532-699aa
Tag Info N-terminal GST-tagged
Mol. Weight 42.8kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May play an important role in fibrillogenesis by controlling lateral growth of collagen II fibrils.
Involvement in disease Stickler syndrome 2 (STL2); Marshall syndrome (MRSHS); Fibrochondrogenesis 1 (FBCG1)
Subcellular Location Secreted, extracellular space, extracellular matrix
Protein Families Fibrillar collagen family
Tissue Specificity Cartilage, placenta and some tumor or virally transformed cell lines. Isoforms using exon IIA or IIB are found in the cartilage while isoforms using only exon IIB are found in the tendon.
Database Links

HGNC: 2186

OMIM: 120280

KEGG: hsa:1301

STRING: 9606.ENSP00000359114

UniGene: Hs.523446

Related Products

COL11A1 Antibodies

COL11A1 Antibodies for Human

COL11A1 Antibodies for Homo sapiens (Human)

COL11A1 ELISA Kit

COL11A1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.