Recombinant Human Cytochrome P450 11B2, mitochondrial(CYP11B2)

Code CSB-YP006391HU
Product Type Recombinant Protein
Size US$2959
Uniprot No. P19099
Relevance Preferentially catalyzes the conversion of 11-deoxycorticosterone to aldosterone via corticosterone and 18-hydroxycorticosterone.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Aldosterone synthase
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence GTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN
Research Area others
Source Yeast
Gene Names CYP11B2
Protein Names Recommended name: Cytochrome P450 11B2, mitochondrial Alternative name(s): Aldosterone synthase Short name= ALDOS EC= 1.14.15.4 EC= 1.14.15.5 Aldosterone-synthesizing enzyme CYPXIB2 Cytochrome P-450Aldo Cytochr
Expression Region 25-503aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 57.0kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Preferentially catalyzes the conversion of 11-deoxycorticosterone to aldosterone via corticosterone and 18-hydroxycorticosterone.
Involvement in disease Corticosterone methyloxidase 1 deficiency (CMO-1 deficiency); Corticosterone methyloxidase 2 deficiency (CMO-2 deficiency); Hyperaldosteronism, familial, 1 (HALD1)
Subcellular Location Mitochondrion membrane
Protein Families Cytochrome P450 family
Database Links

HGNC: 2592

OMIM: 103900

KEGG: hsa:1585

STRING: 9606.ENSP00000325822

UniGene: Hs.632054

Related Products

CYP11B2 Antibodies

CYP11B2 Antibodies for Human

CYP11B2 Proteins

CYP11B2 Proteins for Homo sapiens (Human)

CYP11B2 ELISA Kit

CYP11B2 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.