Recombinant Human Cytochrome P450 11B2, mitochondrial(CYP11B2)

Code CSB-YP006391HU
Size US$1916
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names CYP11B2
Uniprot No. P19099
Research Area others
Alternative Names ALDOS; Aldosterone synthase; Aldosterone-synthesizing enzyme; C11B2_HUMAN; CYP11B2; CYPXIB2; Cytochrome P-450Aldo; Cytochrome P-450C18; Cytochrome P450 11B2; Cytochrome P450 11B2; mitochondrial; mitochondrial; P-450Aldo; P-450C18; Steroid 18-hydroxylase
Species Homo sapiens (Human)
Source Yeast
Expression Region 25-503aa
Target Protein Sequence GTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 57.0kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Preferentially catalyzes the conversion of 11-deoxycorticosterone to aldosterone via corticosterone and 18-hydroxycorticosterone.
Gene References into Functions
  1. Hybrid gene (8q24.3) due to unequal crossing (8q24.3) over cause Na over reabsorption in the distal nephron and volume expansion leading to Monogenic Hypertension Syndrome in children. PMID: 29229168
  2. The research reveals that among patients with essential hypertension treated with hypotensive drugs there are certain relationships between the rs5182 and rs5186 polymorphisms of the AGTR1 gene, as well as between the rs1799998 polymorphism of the CYP11B2 gene and the volume of the carotid bodies. PMID: 29627490
  3. Frequencies and distribution of genotype TT of CYP11B2 (C-344T) gene polymorphism among South African Black women, especially those without HIV infection, may prevent them from developing preeclampsia. PMID: 29523271
  4. Aldosterone-producing adenomas (APAs) exhibit different patterns of CYP11B2 staining that vary from uniform to homogeneous. Approximately 30% of patients with unilateral hyperaldosteronism do not have an APA, but either have an increased number of CYP11B2 expressing micronodules or hyperplasia of the zona glomerulosa. [review] PMID: 29202495
  5. In conclusion, our meta-analysis indicated that subjects with TT genotype might have higher risk of developing LVH in northern Han Chinese. PMID: 28692307
  6. study demonstrated significant genetic interaction on Na intake with child obesity by salt-sensitive genes variations, NEDD4L and CYP11beta2 PMID: 28017963
  7. The combination of the V386A mutation with the variant CYP11B2 173(Arg) only slightly reduces the 18-hydroxylase and 18-oxidase activity, whereas the V386A mutation with the CYP11B2 173(Lys) variant almost abolishes the 18-hydroxylation and 18-oxidation. In both cases the 11-hydroxylase activity is not affected. PMID: 28190867
  8. The AG genotype frequency of single nucleotide polymorphism rs542092383 was significantly associated with an increased risk of Essential Hypertension among northern Han Chinese. PMID: 28953657
  9. the cellular distribution of CYP11B2, CYP11B1, CYP17A1 and KCNJ5 in adrenals from two familial hyperaldosteronism type 3 siblings, was examined. PMID: 27793677
  10. Aging is associated with a pattern of decreased normal zona glomerulosa CYP11B2 expression. PMID: 28566337
  11. CYP11B2 methylation was found in patients with aldosterone producing adenomas. PMID: 27754862
  12. In European continental ancestry patients the C allele (CC or CT) at -344T/C SNP in the aldosterone synthase gene does not significantly influence clinical prognosis of chronic heart failure. PMID: 28625318
  13. his study provided candidates for novel drug-like CYP11B2 inhibitors by molecular simulation methods for the hypertension treatment. PMID: 27781210
  14. Suggest that there is lack of association between -344T/C polymorphism of CYP11B2 gene and coronary heart disease in Malaysian population. PMID: 25890613
  15. Our study is aimed at evaluating the contribution of CYP11B2 promoter methylation to the risk of essential hypertension(EH). Our findings suggest that gene-environment interactions are associated with the pathogenesis and progression of EH PMID: 28078278
  16. The present study revealed a strong synergistic effect of CYP11B2 C-344T and IC polymorphisms causing susceptibility to EHT and haplotype H1 (-344T-Conv-Lys173) as the risk-conferring factor for hypertension predisposition. PMID: 27935319
  17. Deletions, duplications or chimeric CYP11B2/CYP11B1 gene is associated with 11beta-hydroxylase deficiency. PMID: 26280318
  18. CYP11B2 T-344C single nucleotide polymorphism exhibited a strong association with the development of coronary artery disease in Taiwanese women. PMID: 26941570
  19. aldosterone synthase (CYP11B2) gene polymorphism may contribute to diabetic nephropathy development, especially in Asian group, with the T allele acting as a risk factor. PMID: 27009287
  20. There is lack of association between C-344T polymorphism of CYP11B2 gene and Essential Hypertension in Dongxiang and Han populations from northwest of China , whereas the polymorphism was correlated in female population of Tibetan. PMID: 27149293
  21. Polymorphisms of three genes (ACE, AGT and CYP11B2) in the renin-angiotensin-aldosterone system are not associated with blood pressure salt sensitivity. (Meta-analysis) PMID: 26556555
  22. Gene polymorphism of CYP11B2 (-344C>T) may be associated with developing preeclampsia during pregnancy. PMID: 26686590
  23. This meta-analysis is purposed to reveal the relationship between the -344C/T aldosterone synthase variant and the left ventricular structure and function. PMID: 25208931
  24. Strong synergistic effect between ACE and CY11B2 gene polymorphisms in the molecular pathogenesis of Essential Hypertension in Kazakhs in Xinjiang was identified. PMID: 26305278
  25. Adrenal tumors in patients with primary aldosteronism can demonstrate clear heterogeneity in cytochrome P450 family 11 subfamily B member 2 (CYP11B2) expression and somatic mutations in driver genes for aldosterone production PMID: 26765578
  26. The study explores the relation between ACE D/I and CYP11B2 C-344T polymorphisms and parameters of arterial stiffness in the context of renal sodium handling. PMID: 26222001
  27. univariate and multivariable analyses revealed no association between -344C/T of CYP11B2 and plasma glucose in patients with no diabetes, Homeostasis Model Assessment as an Index of Insulin Resistance, or left ventricular mass indexed to height. PMID: 26200036
  28. suggested that the -344T>C polymorphism in Studies suggest that the cytochrome P450 11B2 (CYP11B2) gene might be associated with susceptibility to CAD in Caucasians and Asians. PMID: 25966076
  29. The present meta-analysis supported the positive association of the CYP11B2 -344C/T variant with ischemic stroke. PMID: 23748625
  30. Obesity risk increased with GRK4 A486V and CYP11B2 variants in Korean girls as sodium intake increased. PMID: 25768006
  31. Our pooled data suggest a significant association exists between CYP11B2-344T>C polymorphism and atrial fibrillation among hypertension populations--{REVIEW} PMID: 25354523
  32. findings characterize the haplotype-dependent regulation of the hCYP11B2 gene where -344T serves as a reporter polymorphism and show that Hap-I leads to increased expression of hCYP11B2, with permissive effects on blood pressure and inflammatory milieu. PMID: 25504670
  33. This cataloguing of deleterious SNPs is essential for narrowing down the number of CYP11B2 mutations to be screened in genetic association studies and for a better understanding of the functional and structural aspects of the CYP11B2 protein. PMID: 25102047
  34. polymorphism in the CYP11B2 gene was significantly associated with hypertension in the Chinese population PMID: 23204185
  35. microRNA (miR)-766 binds to the 735G-allele and not the 735A-allele of the hCyp11B2 gene and may downregulate the expression of human aldosterone synthase gene and reduce blood pressure in human subjects containing -344T allele. PMID: 25351194
  36. the CT and TT genotypes of aldosterone synthase C-344T polymorphism, frequency of alcohol consumption and aldosterone levels were significantly high among the total as well as male PMID: 25572238
  37. Our results suggest that the down-regulation of ANP gene expression at mRNA and protein levels and up-regulated CYP11B2 protein expression levels may be correlated with the essential hypertension PMID: 25917967
  38. CYP11B2 -344C/T polymorphism might be an independent risk factor of IgA nephropathy, focal segmental glomerulosclerosis and all proliferative chronic glomerulonephritis. PMID: 23681285
  39. The objective of this study was to assess aldosterone polymorphisms and relationships to plasma aldosterone levels and the development of renal histological lesions in kidney transplant patients. PMID: 23257211
  40. CYP11B2 polymorphism is an independent predictor for atrial fibrillation development in hypertrophic cardiomyopathy patients. PMID: 24599807
  41. CYP11B2 genotype were associated to type 2 diabetes mellitus. PMID: 24549414
  42. GnRH, through heterotopic expression of its receptor, may be a potential regulator of CYP11B2 expression levels in some cases of aldosterone-producing adenoma. PMID: 24472523
  43. Plasma aldosterone concentration is significantly associated with -344 C/T CYP11B2 polymorphism and with the treatment with spironolactone in resistant hypertensive subjects. PMID: 24388430
  44. The 344 C/T polymorphism of the CYP11B2 gene predicts resolution of hypertension in patients undergoing adrnelactomy for aldosterone-producing adenoma. PMID: 22650983
  45. tumor area in aldosterone-producing adenoma specimens was correlated with preoperative plasma aldosterone, urinary aldosterone excretion, and the H score of 11beta-hydroxylase and was inversely correlated with the H score of aldosterone synthase. PMID: 24842915
  46. Aldosteronomas are hypomethylated, and CYP11B2 is overexpressed and hypomethylated in these tumors. PMID: 24423307
  47. The C-344T aldosterone synthase gene variant is associated with preclinical vascular alterations in essential hypertension. PMID: 23490082
  48. The present meta-analysis suggested that CYP11B2 C-344T polymorphism was unlikely contribute to ischemic stroke susceptibility. PMID: 23950878
  49. -344C allele may be associated with decreased risk of Idiopathic hyperaldosteronism; there was still no enough evidence to indicate the association of A2718G polymorphism with Primay aldosteronism risk. PMID: 23535359
  50. the CYP11B2 -344CC genotype was a significant and independent predictor of AF beyond conventional clinical and echocardiographic predictors of AF and genetic ancestry. It also associated with extreme elevation of serum aldosterone. PMID: 23936266
  51. Of 41 SNPs genotyped, rs3789678 and rs2493132 within AGT, rs4305 within ACE, rs275645 within AGTR1, rs3802230 and rs10086846 within CYP11B2 were shown to associate with hypertension. PMID: 24015270
  52. findings suggest that the -344C/T polymorphism of the CYP11B2 gene confers an increased risk of recurrent cerebral ischemia PMID: 23701507
  53. study has shown that C-344T aldosterone synthase potentially predicts higher values of left ventricular mass index and concentric hypertrophy in untreated hypertension independently of renal function and subclinical inflammation PMID: 23479071
  54. low ratio of cytochrome P450 family 17/3 beta-hydroxysteroid dehydrogenase type II with high expression of steroid 11-beta-monooxygenase seems to explain steroidogenic characteristics of aldosterone-producing adenomas PMID: 23257735
  55. CYP11B2 T-344C polymorphism affects left ventricular structures only in the female hypertensive population. This gender-difference needs to be further elucidated. PMID: 23275203
  56. CYP11B2 immunostaining is a powerful tool for histopathological diagnosis of aldosterone overproduction in primary aldosteronism and for subtype classification of Aldesterone-producing adenomas and diffuse hyperplasia. PMID: 23443813
  57. Significant differences in the gene expression of aldosterone synthase and adrenocorticotropic hormone receptor distinguishes adrenal neoplasms from primary aldosteronism. PMID: 23023242
  58. Individuals with the C allele of CYP11B2 T-344C gene polymorphism have higher risk for atrial fibrillation. PMID: 23209837
  59. reports the first CYP11B2 defects in Southeast Asian families responsible for aldosterone synthase deficiency and identifies a novel mutation (c.666delC)inherited from both parents. PMID: 22801770
  60. The findings of this study suggested a significant association of CYP11B2 (-344C/T) polymorphism with stroke but intron 2 polymorphism is not associated with increased stroke susceptibility. PMID: 23135028
  61. Report role of CYP11B2 in metandienone metabolism. PMID: 22885098
  62. Small molecule inhibition of the APEX1 repressor or treatment with small interfering RNA (siRNA) leads to increased CYP11B2 transcription. PMID: 22652909
  63. The G allele of CYP11B2 rs1799998 polymorphism is highly associated with coronary heart disease and severity of coronary atherosclerosis. Interaction of rs1799998, age, and smoking status is also associated with enhanced risk of coronary artery disease. PMID: 22508051
  64. This study demonstrates a novel insight into intracellular mechanism of VLDL-mediated aldosterone synthesis through transcriptional regulation of steroidogenic acute regulatory protein and Cyp11B2 expression. PMID: 22331364
  65. For female patients, no association was found between CYP11B2 -344T/C polymorphism and aldosterone level. PMID: 22311496
  66. The present investigation demonstrates a possible association between the polymorphisms existing in the renin-angiotensin-aldosterone system pathway T174M and CYP11B2 C-344T and sensitivity of an individual to develop high-altitude pulmonary edema. PMID: 22156739
  67. The epistasis between CYP11B2 and NOS3 and its correlation with varied clinical and biochemical parameters signify its possible contribution in the complex etiology of hypertension. PMID: 22134143
  68. The -344T/C polymorphism in the aldostrone synthase gene is not associated with atrial fibrillation but it might be associated with atrial remodelling in hypertensives. PMID: 21846681
  69. The aldosterone synthase (CYP11B2) gene -344T>C polymorphism was found to be associated with essential hypertension (odds ratio 1.252; 95% confidence interval 1.067-1.468; P(add) = 0.006). PMID: 21682760
  70. Aldosterone synthase gene C-344T polymorphism not only acts as a risk factor for the development of focal segmental glomerulosclerosis, but also may influence its pathologic appearance. PMID: 21777344
  71. The polymorphism of C-344T in the promoter region of the CYP11B2 gene was associated with electrocardiogram left ventricular hypervoltage in the Keriyan population. PMID: 21357309
  72. CYP11B2 gene -344T/C polymorphism was associated with essential hypertension in Chinese Mongolian population. PMID: 21092623
  73. C-344T polymorphism is a risk factor for accelerated progression in Caucasian patients with IgA nephropathy. PMID: 21476902
  74. PPAR-gamma suppresses CYP11B2 expression/aldosterone secretion through calcium/calmodulin-dependent kinase I, which may account for the suppressive effects of PPAR-gamma on vascular events associated with atherosclerosis and hypertension. PMID: 21106862
  75. the genotype of -344T/C of CYP11B2 was neither related with gestational hypertension nor with aldosterone levels at delivery. PMID: 20535141
  76. the rs3802230 C allele might be a risk marker for essential hypertension and haplotype AAGC might confer high genetic susceptibility to essential hypertension in a southwest Han Chinese population PMID: 21269059
  77. Haplotype AGGC in the aldosterone synthase gene conferred an increased risk for hypertension in the Hani minority males in China. PMID: 21127960
  78. these results suggest that genetic variation rs1799998 (-344C/T) of CYP11B2 gene may contribute to the risk of IS with moderate effect in Han Chinese population. PMID: 21228735
  79. Demonstrates interaction between the CYP11B2 genotype and alcohol consumption on the risk of hypertension in Chinese Mongolian population. PMID: 20878543
  80. The effects of high-density lipoprotein subtypes on the production of aldosterone and CYP11B2 expression in human adrenal cortex cells are reported. PMID: 21239432
  81. Among the ACE, AGT, AT1R and CYP gene polymorphisms, only the DD genotype may predispose the individual to increased risk of progression to Eend-stage renal disease in the Chinese population. PMID: 21163122
  82. association between the CYP11b2 genotype and diastolic BP was modified by BMI and WC, suggesting an interaction of the C-344T polymorphism of CYP11b2 with BMI and WC in a Chinese Mongolian population. PMID: 20560800
  83. Increased expression of CYPIIB2 in the atria is one of the molecular mechanisms for the development of atrial interstitial fibrosis in patients with atrial fibrillation. PMID: 21125974
  84. Genetic variations in aldosterone synthase (CYP11B2) gene are associated with the progression of atherosclerotic plaque size, MMP-9 and apoptosis in the carotid artery. PMID: 20123934
  85. The chimeric gene CYP11B1/CYP11B2 (crossover to be located between intron 2 of CYP11B1 and exon 3 of CYP11B2) cause Glucocorticoid-remediable aldosteronism. (CTP11B2) PMID: 20808686
  86. Compared to CC genotype, CT and TT CYP11B2 genotypes are independently associated with increased stroke index. PMID: 20176774
  87. our study suggests that -344T allele of CYP11B2 gene is an important risk factor for hypertension and ischemic stroke PMID: 20598712
  88. Aldosterone-producing adenoma patients were genotyped for rs1799998 (C-344 T), intron 2 conversion, & rs4539 (A2718G). DNA polymorphisms at CYP11B2/B1 locus may confer susceptibility to postoperative hypertension of patients with APA. PMID: 20708777
  89. No significant association was observed between CYP11B2 -344 C/T polymorphism and hypertension susceptibility in both sexes nor any association between the etiology of essential hypertension and CYP11B2 - 344 C/T polymorphism in Han Chinese. PMID: 20662731
  90. The first CYP11B2 gene defects in two Polish families associated with phenotypes of aldosterone synthase deficiency type I. PMID: 20494601
  91. CN mediates the Ang II-induced aldosterone synthesis through up-regulation of the CYP11B2 transcription. PMID: 20413672
  92. The CYP11B2 CT and TT genotypes are candidates for hypertension complicating stroke in the Mongolian population PMID: 20831027
  93. Aldosterone synthase C-344T polymorphism is irrelavant for the development of hypertension. PMID: 20182453
  94. The -344 T>C and 3097 G>A polymorphisms in the CYP11B2 are associated with type 2 diabetes, hypertension and the metabolic syndrome in European subjects with gender variations. PMID: 20224556
  95. Three polymorphisms that are associated with the variation in baroreflex sensitivity were identified in the eNOS, CYP11B2, and B2R genes, respectively; overall, they accounted for 16% of the BRS variation. PMID: 20300066
  96. The CC genotype of the CYP11B2 C-344T polymorphism was associated with an age-dependent increase in the serum C-reactive protein level independent of blood pressure. PMID: 20094057
  97. in hypertensive individuals, ASGP is not directly associated with the blood pressure level, but rather independently with its two main determinants, central pulse wave velocity and wave reflections PMID: 19609286
  98. The CYP11B2 K173R polymorphism correlates with the susceptibility of essential hypertension in the northern Chinese Han population. PMID: 17633457
  99. Essential hypertension might positively be affected by the interaction of the C (-344) T polymorphism of CYP11B2 and the drinking index in Chinese Mongolian population. PMID: 20193236
  100. Our result suggested that polymorphisms of rs4545 in CYP11B2 gene might not be associated with atrial fibrillation but polymorphism of 3'UTR rs3802228 locus in CYP11B2 gene might be associated with atrial structural remodeling. PMID: 20193392

Show More

Hide All

Involvement in disease Corticosterone methyloxidase 1 deficiency (CMO-1 deficiency); Corticosterone methyloxidase 2 deficiency (CMO-2 deficiency); Hyperaldosteronism, familial, 1 (HALD1)
Subcellular Location Mitochondrion membrane
Protein Families Cytochrome P450 family
Database Links

HGNC: 2592

OMIM: 103900

KEGG: hsa:1585

STRING: 9606.ENSP00000325822

UniGene: Hs.632054

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1