Recombinant Human Cytochrome P450 11B2, mitochondrial (CYP11B2)

In Stock
Code CSB-EP006391HU
Abbreviation Recombinant Human CYP11B2 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Alternative Names
ALDOS; Aldosterone synthase; Aldosterone-synthesizing enzyme; C11B2_HUMAN; CYP11B2; CYPXIB2; Cytochrome P-450Aldo; Cytochrome P-450C18; Cytochrome P450 11B2; Cytochrome P450 11B2; mitochondrial; mitochondrial; P-450Aldo; P-450C18; Steroid 18-hydroxylase
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
25-503
Target Protein Sequence
GTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
71.0kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Human CYP11B2 was expressed with the amino acid range of 25-503. The calculated molecular weight for this CYP11B2 protein is 71 kDa. This CYP11B2 protein is produced using e.coli expression system. The CYP11B2 gene fragment has been modified by fusing the N-terminal 6xHis-SUMO tag, providing convenience in detecting and purifying the recombinant CYP11B2 protein during the following stages.

Human cytochrome P450 11B2 (CYP11B2) is a mitochondrial enzyme crucial for aldosterone biosynthesis in the adrenal glands. CYP11B2 catalyzes the final steps in the synthesis of aldosterone, a mineralocorticoid hormone that regulates electrolyte and fluid balance by acting on the kidneys. Aldosterone, in turn, plays a key role in maintaining blood pressure and electrolyte homeostasis by promoting sodium retention and potassium excretion in the kidneys. Dysfunction of CYP11B2 can lead to disorders such as hyperaldosteronism, impacting blood pressure regulation. Research on CYP11B2 contributes to understanding adrenal steroidogenesis and potential therapeutic targets for related conditions.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
A cytochrome P450 monooxygenase that catalyzes the biosynthesis of adrenal mineralocorticoid aldosterone. Catalyzes three sequential oxidative reactions of 11-deoxycorticosterone/21-hydroxyprogesterone, namely 11-beta hydroxylation followed with two successive oxidations at C18 to yield 18-hydroxy and then 18-aldehyde derivatives, resulting in the formation of aldosterone. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate and reducing the second into a water molecule. Two electrons are provided by NADPH via a two-protein mitochondrial transfer system comprising flavoprotein FDXR (adrenodoxin/ferredoxin reductase) and nonheme iron-sulfur protein FDX1 or FDX2 (adrenodoxin/ferredoxin).
Gene References into Functions
  1. Hybrid gene (8q24.3) due to unequal crossing (8q24.3) over cause Na over reabsorption in the distal nephron and volume expansion leading to Monogenic Hypertension Syndrome in children. PMID: 29229168
  2. The research reveals that among patients with essential hypertension treated with hypotensive drugs there are certain relationships between the rs5182 and rs5186 polymorphisms of the AGTR1 gene, as well as between the rs1799998 polymorphism of the CYP11B2 gene and the volume of the carotid bodies. PMID: 29627490
  3. Frequencies and distribution of genotype TT of CYP11B2 (C-344T) gene polymorphism among South African Black women, especially those without HIV infection, may prevent them from developing preeclampsia. PMID: 29523271
  4. Aldosterone-producing adenomas (APAs) exhibit different patterns of CYP11B2 staining that vary from uniform to homogeneous. Approximately 30% of patients with unilateral hyperaldosteronism do not have an APA, but either have an increased number of CYP11B2 expressing micronodules or hyperplasia of the zona glomerulosa. [review] PMID: 29202495
  5. In conclusion, our meta-analysis indicated that subjects with TT genotype might have higher risk of developing LVH in northern Han Chinese. PMID: 28692307
  6. study demonstrated significant genetic interaction on Na intake with child obesity by salt-sensitive genes variations, NEDD4L and CYP11beta2 PMID: 28017963
  7. The combination of the V386A mutation with the variant CYP11B2 173(Arg) only slightly reduces the 18-hydroxylase and 18-oxidase activity, whereas the V386A mutation with the CYP11B2 173(Lys) variant almost abolishes the 18-hydroxylation and 18-oxidation. In both cases the 11-hydroxylase activity is not affected. PMID: 28190867
  8. The AG genotype frequency of single nucleotide polymorphism rs542092383 was significantly associated with an increased risk of Essential Hypertension among northern Han Chinese. PMID: 28953657
  9. the cellular distribution of CYP11B2, CYP11B1, CYP17A1 and KCNJ5 in adrenals from two familial hyperaldosteronism type 3 siblings, was examined. PMID: 27793677
  10. Aging is associated with a pattern of decreased normal zona glomerulosa CYP11B2 expression. PMID: 28566337
  11. CYP11B2 methylation was found in patients with aldosterone producing adenomas. PMID: 27754862
  12. In European continental ancestry patients the C allele (CC or CT) at -344T/C SNP in the aldosterone synthase gene does not significantly influence clinical prognosis of chronic heart failure. PMID: 28625318
  13. his study provided candidates for novel drug-like CYP11B2 inhibitors by molecular simulation methods for the hypertension treatment. PMID: 27781210
  14. Suggest that there is lack of association between -344T/C polymorphism of CYP11B2 gene and coronary heart disease in Malaysian population. PMID: 25890613
  15. Our study is aimed at evaluating the contribution of CYP11B2 promoter methylation to the risk of essential hypertension(EH). Our findings suggest that gene-environment interactions are associated with the pathogenesis and progression of EH PMID: 28078278
  16. The present study revealed a strong synergistic effect of CYP11B2 C-344T and IC polymorphisms causing susceptibility to EHT and haplotype H1 (-344T-Conv-Lys173) as the risk-conferring factor for hypertension predisposition. PMID: 27935319
  17. Deletions, duplications or chimeric CYP11B2/CYP11B1 gene is associated with 11beta-hydroxylase deficiency. PMID: 26280318
  18. CYP11B2 T-344C single nucleotide polymorphism exhibited a strong association with the development of coronary artery disease in Taiwanese women. PMID: 26941570
  19. aldosterone synthase (CYP11B2) gene polymorphism may contribute to diabetic nephropathy development, especially in Asian group, with the T allele acting as a risk factor. PMID: 27009287
  20. There is lack of association between C-344T polymorphism of CYP11B2 gene and Essential Hypertension in Dongxiang and Han populations from northwest of China , whereas the polymorphism was correlated in female population of Tibetan. PMID: 27149293
  21. Polymorphisms of three genes (ACE, AGT and CYP11B2) in the renin-angiotensin-aldosterone system are not associated with blood pressure salt sensitivity. (Meta-analysis) PMID: 26556555
  22. Gene polymorphism of CYP11B2 (-344C>T) may be associated with developing preeclampsia during pregnancy. PMID: 26686590
  23. This meta-analysis is purposed to reveal the relationship between the -344C/T aldosterone synthase variant and the left ventricular structure and function. PMID: 25208931
  24. Strong synergistic effect between ACE and CY11B2 gene polymorphisms in the molecular pathogenesis of Essential Hypertension in Kazakhs in Xinjiang was identified. PMID: 26305278
  25. Adrenal tumors in patients with primary aldosteronism can demonstrate clear heterogeneity in cytochrome P450 family 11 subfamily B member 2 (CYP11B2) expression and somatic mutations in driver genes for aldosterone production PMID: 26765578
  26. The study explores the relation between ACE D/I and CYP11B2 C-344T polymorphisms and parameters of arterial stiffness in the context of renal sodium handling. PMID: 26222001
  27. univariate and multivariable analyses revealed no association between -344C/T of CYP11B2 and plasma glucose in patients with no diabetes, Homeostasis Model Assessment as an Index of Insulin Resistance, or left ventricular mass indexed to height. PMID: 26200036
  28. suggested that the -344T>C polymorphism in Studies suggest that the cytochrome P450 11B2 (CYP11B2) gene might be associated with susceptibility to CAD in Caucasians and Asians. PMID: 25966076
  29. The present meta-analysis supported the positive association of the CYP11B2 -344C/T variant with ischemic stroke. PMID: 23748625
  30. Obesity risk increased with GRK4 A486V and CYP11B2 variants in Korean girls as sodium intake increased. PMID: 25768006
  31. Our pooled data suggest a significant association exists between CYP11B2-344T>C polymorphism and atrial fibrillation among hypertension populations--{REVIEW} PMID: 25354523
  32. findings characterize the haplotype-dependent regulation of the hCYP11B2 gene where -344T serves as a reporter polymorphism and show that Hap-I leads to increased expression of hCYP11B2, with permissive effects on blood pressure and inflammatory milieu. PMID: 25504670
  33. This cataloguing of deleterious SNPs is essential for narrowing down the number of CYP11B2 mutations to be screened in genetic association studies and for a better understanding of the functional and structural aspects of the CYP11B2 protein. PMID: 25102047
  34. polymorphism in the CYP11B2 gene was significantly associated with hypertension in the Chinese population PMID: 23204185
  35. microRNA (miR)-766 binds to the 735G-allele and not the 735A-allele of the hCyp11B2 gene and may downregulate the expression of human aldosterone synthase gene and reduce blood pressure in human subjects containing -344T allele. PMID: 25351194
  36. the CT and TT genotypes of aldosterone synthase C-344T polymorphism, frequency of alcohol consumption and aldosterone levels were significantly high among the total as well as male PMID: 25572238
  37. Our results suggest that the down-regulation of ANP gene expression at mRNA and protein levels and up-regulated CYP11B2 protein expression levels may be correlated with the essential hypertension PMID: 25917967
  38. CYP11B2 -344C/T polymorphism might be an independent risk factor of IgA nephropathy, focal segmental glomerulosclerosis and all proliferative chronic glomerulonephritis. PMID: 23681285
  39. The objective of this study was to assess aldosterone polymorphisms and relationships to plasma aldosterone levels and the development of renal histological lesions in kidney transplant patients. PMID: 23257211
  40. CYP11B2 polymorphism is an independent predictor for atrial fibrillation development in hypertrophic cardiomyopathy patients. PMID: 24599807
  41. CYP11B2 genotype were associated to type 2 diabetes mellitus. PMID: 24549414
  42. GnRH, through heterotopic expression of its receptor, may be a potential regulator of CYP11B2 expression levels in some cases of aldosterone-producing adenoma. PMID: 24472523
  43. Plasma aldosterone concentration is significantly associated with -344 C/T CYP11B2 polymorphism and with the treatment with spironolactone in resistant hypertensive subjects. PMID: 24388430
  44. The 344 C/T polymorphism of the CYP11B2 gene predicts resolution of hypertension in patients undergoing adrnelactomy for aldosterone-producing adenoma. PMID: 22650983
  45. tumor area in aldosterone-producing adenoma specimens was correlated with preoperative plasma aldosterone, urinary aldosterone excretion, and the H score of 11beta-hydroxylase and was inversely correlated with the H score of aldosterone synthase. PMID: 24842915
  46. Aldosteronomas are hypomethylated, and CYP11B2 is overexpressed and hypomethylated in these tumors. PMID: 24423307
  47. The C-344T aldosterone synthase gene variant is associated with preclinical vascular alterations in essential hypertension. PMID: 23490082
  48. The present meta-analysis suggested that CYP11B2 C-344T polymorphism was unlikely contribute to ischemic stroke susceptibility. PMID: 23950878
  49. -344C allele may be associated with decreased risk of Idiopathic hyperaldosteronism; there was still no enough evidence to indicate the association of A2718G polymorphism with Primay aldosteronism risk. PMID: 23535359
  50. the CYP11B2 -344CC genotype was a significant and independent predictor of AF beyond conventional clinical and echocardiographic predictors of AF and genetic ancestry. It also associated with extreme elevation of serum aldosterone. PMID: 23936266

Show More

Hide All

Involvement in disease
Corticosterone methyloxidase 1 deficiency (CMO-1 deficiency); Corticosterone methyloxidase 2 deficiency (CMO-2 deficiency); Hyperaldosteronism, familial, 1 (HALD1)
Subcellular Location
Mitochondrion inner membrane; Peripheral membrane protein.
Protein Families
Cytochrome P450 family
Database Links

HGNC: 2592

OMIM: 103900

KEGG: hsa:1585

STRING: 9606.ENSP00000325822

UniGene: Hs.632054

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*