Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
ALDOS; Aldosterone synthase; Aldosterone-synthesizing enzyme; C11B2_HUMAN; CYP11B2; CYPXIB2; Cytochrome P-450Aldo; Cytochrome P-450C18; Cytochrome P450 11B2; Cytochrome P450 11B2; mitochondrial; mitochondrial; P-450Aldo; P-450C18; Steroid 18-hydroxylase
Species
Homo sapiens (Human)
Target Protein Sequence
GTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Human CYP11B2 was expressed with the amino acid range of 25-503. The calculated molecular weight for this CYP11B2 protein is 71 kDa. This CYP11B2 protein is produced using e.coli expression system. The CYP11B2 gene fragment has been modified by fusing the N-terminal 6xHis-SUMO tag, providing convenience in detecting and purifying the recombinant CYP11B2 protein during the following stages.
Human cytochrome P450 11B2 (CYP11B2) is a mitochondrial enzyme crucial for aldosterone biosynthesis in the adrenal glands. CYP11B2 catalyzes the final steps in the synthesis of aldosterone, a mineralocorticoid hormone that regulates electrolyte and fluid balance by acting on the kidneys. Aldosterone, in turn, plays a key role in maintaining blood pressure and electrolyte homeostasis by promoting sodium retention and potassium excretion in the kidneys. Dysfunction of CYP11B2 can lead to disorders such as hyperaldosteronism, impacting blood pressure regulation. Research on CYP11B2 contributes to understanding adrenal steroidogenesis and potential therapeutic targets for related conditions.