Recombinant Human Gastrokine-1 (GKN1)

Code CSB-MP868309HUc7
Abbreviation Recombinant Human GKN1 protein
MSDS
Size $190
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
35-199aa
Target Protein Sequence
NYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Has mitogenic activity and may be involved in maintaining the integrity of the gastric mucosal epithelium.
Gene References into Functions
  1. Data show that ubiquitin protein ligase E3 component n-recognin 5 protein (UBR5) bound the tumor suppressor gastrokine 1 (GKN1) and increased its ubiquitination to reduce the protein stability of GKN1. PMID: 27590582
  2. These results did not confirm GKN1 as a potential biomarker for gastric cancer. PMID: 27452910
  3. Low GKN1 expression is associated with gastric cancer. PMID: 27250838
  4. GKN1 may contribute to the maintenance of gastric epithelial homeostasis and inhibit gastric carcinogenesis by down-regulating the gastrin-cholecystokinin B receptor signaling pathway. PMID: 25752269
  5. Gastrokine 1 indirectly participates in actin stabilization since its overexpression in gastric cancer cells strongly increases the expression of tight and adherens junction proteins PMID: 26008777
  6. AMP-18 appears to act through PI3K/AKT pathways to increase p21 phosphorylation, thereby reducing its nuclear accumulation to overcome the antiproliferative effects of TNF-alpha. PMID: 25919700
  7. Results suggest a potential association between CRP and GPC5 variants with lung cancer risk; variation in GKN1 is associated with chemotherapy response in the Chinese Han population. PMID: 25999661
  8. GKN1 inhibits metastasis in gastric cancer cells. PMID: 25725220
  9. GKN1 may shorten telomeres by acting as a potential c-myc inhibitor that eventually leads to senescence and apoptosis in gastric cancer cells PMID: 25344918
  10. GKN1 expression in the gastric mucosa of gastric cancer patients is decreased; this is associated with progression and prognosis of gastric cancer. PMID: 25469040
  11. Data show that recombinant gastrokine 1 (GKN1) interacts with amyloid-beta peptide (1-40) preventing its aggregation. PMID: 25139219
  12. These results suggest that GKN1 might be a target to inhibit the effects from H.pylori CagA. PMID: 25239641
  13. Low GKN1 activity is associated with gastric cancers. PMID: 23812904
  14. Epstein-Barr virus EBNA1 binds to the divergent promoter of the GKN1 and GKN2 genes and contributes to the complex transcriptional and epigenetic deregulation of the GKN1 and GKN2 tumor suppressor genes. PMID: 24460791
  15. Our results show that GKN1 has an miR-185-dependent and -independent mechanism for chromatic and DNA epigenetic modification, thereby regulating the cell cycle PMID: 23846337
  16. Data suggest GKN1 is expressed in placental trophoblasts in third trimester (not first); GKN1 expression is limited to extravillous trophoblasts. GKN1 expression is downregulated in choriocarcinoma; GKN1 attenuates migration of choriocarcinoma cells. PMID: 23993393
  17. These data demonstrate that in the presence of GKN2, GKN1 loses its ability to decrease cell proliferation, induce apoptosis, and inhibit epigenetic alterations in gastric cancer cells. PMID: 24151046
  18. these results suggest that the NH2-terminal hydrophobic region and BRICHOS domain of GKN1 are sufficient for its tumor suppressor activities. PMID: 24099765
  19. the GKN1 gene may inhibit progression of gastric epithelial cells to cancer cells by regulating NF-kappaB signaling pathway and cytokine expression. PMID: 23444260
  20. Molecular and functional properties of human GKN1 indicate a more significant propensity for beta-sheet structures. PMID: 23319233
  21. Low expression of gastrokine 1 is associated with gastric cancer. PMID: 23317277
  22. Expression of GKN1 is progressively lost from normal mucosa, precancerous to cancerous gastric tissues, while restoration of GKN1 expression induces gastric cancer cells to undergo apoptosis. PMID: 22621392
  23. There is no direct molecular interaction between GKN1 and TFF1 in protein level in gastric cancer. PMID: 22842654
  24. Both Helicobacter pylori infection and long-term non-steroidal anti-inflammatory drug administration downregulate gastrokine-1 expression in the gastric mucosa, which may contribute to the gastric mucosal injuries induced by these two factors. PMID: 22798109
  25. GKN1 inhibits gastric cancer cell proliferation. PMID: 21751384
  26. The GKN1 gene may play an important role in the progression of sporadic gastric cancers via inhibition of EMT and cancer cell migration PMID: 21898090
  27. GKN1 modulates apoptotic signals and might play an important role for tissue repair during the early stages of neoplastic transformation. PMID: 21792914
  28. AMP-18 could protect the intestinal mucosal barrier by acting on specific tight junction proteins and stabilizing perijunctional actin PMID: 15961882
  29. study demonstrated the presence of gastrokine-1 isoforms of which the basic isoform was reduced in a subset of patients with H. pylori infection. PMID: 17092786
  30. GKN1 and GKN2 expression occurs frequently in gastric adenocarcinomas, especially in the diffuse subtype PMID: 18593995
  31. GKN1 expression is related to the inflammatory damage of gastric mucosa and could be the related to the gastric cellular phenotype. PMID: 18927498

Show More

Hide All

Subcellular Location
Secreted. Cytoplasmic granule. Golgi apparatus.
Protein Families
Gastrokine family
Tissue Specificity
Expressed in stomach (at protein level). No expression is detected in cancer tissue or gastric cancer cell lines.
Database Links

HGNC: 23217

OMIM: 606402

KEGG: hsa:56287

STRING: 9606.ENSP00000367172

UniGene: Hs.69319

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*