Recombinant Human Heterogeneous nuclear ribonucleoprotein L(HNRNPL),partial

Code CSB-EP010612HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P14866
Relevance Splicing factor binding to exonic or intronic sites and acting as either an activator or repressor of exon inclusion. Exhibits a binding preference for CA-rich elents. Component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complexes and associated with most nascent transcripts. Associates, together with APEX1, to the negative calcium responsive elent (nCaRE) B2 of the APEX2 promoter.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence GENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHDEGYGP
Research Area Epigenetics and Nuclear Signaling
Source E.coli
Gene Names HNRNPL
Protein Names Recommended name: Heterogeneous nuclear ribonucleoprotein L Short name= hnRNP L
Expression Region 89-335aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 43.1kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Splicing factor binding to exonic or intronic sites and acting as either an activator or repressor of exon inclusion. Exhibits a binding preference for CA-rich elements
Subcellular Location Nucleus, nucleoplasm, Cytoplasm
Database Links

HGNC: 5045

OMIM: 164021

KEGG: hsa:3191

STRING: 9606.ENSP00000221419

UniGene: Hs.644906

Related Products

HNRNPL Antibodies

HNRNPL Antibodies for Homo sapiens (Human)

HNRNPL Antibodies for Human

HNRNPL Proteins

HNRNPL Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.