Recombinant Human Heterogeneous nuclear ribonucleoprotein L (HNRNPL), partial

Code CSB-BP010612HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP010612HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP010612HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
HNRNPL
Uniprot No.
Alternative Names
D830027H13Rik; FLJ35509; Heterogeneous nuclear ribonucleoprotein L; hnRNP L; hnRNP-L; Hnrnpl; hnRPL; HNRPL_HUMAN; P/OKcl.14
Species
Homo sapiens (Human)
Expression Region
89-335
Target Protein Sequence
GENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHDEGYGP
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Splicing factor binding to exonic or intronic sites and acting as either an activator or repressor of exon inclusion. Exhibits a binding preference for CA-rich elements. Component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complexes and associated with most nascent transcripts. Associates, together with APEX1, to the negative calcium responsive element (nCaRE) B2 of the APEX2 promoter.
Gene References into Functions
  1. High expression of HnRNP L is associated with oral squamous cell carcinoma. PMID: 27808105
  2. uc.345 could upregulate the hnRNPL expression and that inhibition of (hnRNPL) dampens the tumorigenesis capability of uc.345. PMID: 27689400
  3. HnRNP L is a novel regulator of HPV16 RNA processing.HnRNP L controls HPV16 RNA polyadenylation and splicing in an Akt kinase-dependent manner. PMID: 28934469
  4. Translation of VEGFA mRNA in myeloid cells is dictated by a bi-directional interaction between miR-574-3p, a CA-rich microRNA, and hnRNP L. In normoxia, miR-574-3p, acting as a decoy, binds cytoplasmic hnRNP L and prevents its binding to the CARE and stimulation of VEGFA mRNA translation, simultaneously permitting miR-297-mediated translational silencing. PMID: 28520992
  5. High HNRNPL expression is associated with prostate cancer. PMID: 28038443
  6. hnRNP-L contributes to poor prognosis and tumor progression of BC by inhibiting the intrinsic apoptotic signaling and enhancing MAPK signaling pathways PMID: 28088793
  7. hnRNP L inhibits proximal 5'SS but promotes two consecutive distal 5'SS splicing, antagonizing SRSF1 roles in KLF6 pre-mRNA splicing. PMID: 28119102
  8. HNRNPL acts as the adaptor to combine the two substructures and form the intact Sam68 nuclear body through the interaction of two sets of RNA recognition motifs with the putative architectural RNA in the respective substructures. PMID: 27377249
  9. hnRNP L controls inclusion of a broad spectrum of alternative cassette exons in T cells. PMID: 26437669
  10. The study presents the structural characterization of the RNA recognition motif domains of hnRNP-L and demonstrate their function in repressing exon 4 of SLC2A2. PMID: 26051023
  11. Data suggest that incorporation of 3(S)-methyl-beta-alanine into a short alpha-helical region of nucleic acid binding domain of hnRNP LL significantly stabilizes helix without affecting its DNA binding properties. PMID: 25982410
  12. Our results reveal that hnRNP L is a new regulator for CD44 V10 exon splicing. PMID: 25623890
  13. hnRNP K and hnRNP L may serve as A1CF-like cofactors in AID-mediated class switch recombination and somatic hypermutation PMID: 25902538
  14. Results show that HNRNPL represses splicing when bound to intronic regions upstream of alternative exons, and in contrast, activates splicing when bound to the downstream intron. PMID: 24526010
  15. hnRNP L is a potential biomarker for the diagnosis of HBV-HCC and show that hnRNP L contributes to HCC progression. PMID: 24125732
  16. HnRNP L and hnRNP LL antagonistically modulate PTB-mediated splicing suppression of CHRNA1 pre-mRNA. PMID: 24121633
  17. THRIL has a role in regulating TNFalpha expression through its interaction with hnRNPL PMID: 24371310
  18. Data show that alternative exons with weak 5' splice site sequences specifically show a strong correlation between hnRNP L binding and hnRNP L-dependent splicing regulation. PMID: 24164894
  19. functional component of hnRNP LL is consistent with the fact that the full-length hnRNP LL has a greater silencing activity than hnRNP L PMID: 23646903
  20. Induction of caspase-9b expression is due to activation of hnRNP L via phosphorylation to compete/inhibit hnRNP U association with exon 3 of Casp9 mRNA. PMID: 23396972
  21. hnRNP L represses CD45 exon 4 by recruiting hnRNP A1 to a sequence upstream of the 5' splice site PMID: 23394998
  22. HnRNPL is a key factor involved in the spermatogenesis by functional proteomic studies of azoospermia patients with sertoli cell only syndrome. PMID: 22245417
  23. Constitutive deletion of splicing factor hnRNP L impedes early embryonic development of transgenic mice. PMID: 22523384
  24. NSP 5a3a's novel interaction with B23 and ribonuclear protein hnRNP-L implicates NSP 5a3a in cellular processes such as ribosome biogenesis and rRNA transcription . PMID: 20237420
  25. Hypoxia induces translocation of nuclear hnRNP L to the cytoplasm, which markedly increases hnRNP L binding to VEGFA mRNA thereby inhibiting miRNA activity. PMID: 21343907
  26. hnRNP L represses splicing by preventing 5' splice site recognition of the U1 snRNP. PMID: 19946215
  27. The binding of hnRNP L to an exon represses strong splice sites but enhances weak splice sites. PMID: 20122404
  28. identified hnRNP L as a novel Sam68-interacting protein partner. PMID: 19912651
  29. AP-endonuclease 1 and hnRNP-L interact with a nCaRE-like repressor element in the AP-endonuclease 1 promoter PMID: 11809897
  30. HnRNP L may be involved in the regulation of many other genes containing CA repeats or A/C-rich enhancers. PMID: 12447348
  31. hnRNP L plays roles in enhancing stability, polyadenylation, and nucleocytoplasmic export; it does so by directly recruiting to intronless pre-mRNA processing enhancer (PPE) element-containing RNAs cofactors normally recruited to intron-containing RNAs. PMID: 16024770
  32. 11 target genes of hnRNP L were describes. PMID: 18073345
  33. hnRNP L is an essential component of CaMKIV-regulated alternative splicing through CA repeats, with its phosphorylation likely playing a critical role. PMID: 19017650
  34. These results strongly demonstrate the functional requirement of cellular hnRNP L for the HCV internal ribosome entry site activity. PMID: 19061868
  35. hnRNP L cross-regulates inclusion of an analogous poison exon in the hnRNP L-like pre-mRNA, which explains the reciprocal expression of the two closely related hnRNP L proteins. PMID: 19124611
  36. CA repeats in the 3'UTR of bcl-2 mRNA interact with hnRNP L in vitro and in vivo; this physical association is partially involved in the decay of bcl-2 mRNA. PMID: 19298794
  37. Identification of a novel, higher eukaryotic specific subunit, heterogeneous nuclear ribonucleoprotein L (HnRNP-L)required for lysine methylation in vivo. PMID: 19332550
  38. confirm the interactions of eEF1A1, p54(nrb), hnRNP-L, GAPDH and ASF/SF2 with the right terminal stem-loop domain of HDV genomic RNA in vitro PMID: 19464723

Show More

Hide All

Subcellular Location
Nucleus, nucleoplasm. Cytoplasm.
Database Links

HGNC: 5045

OMIM: 164021

KEGG: hsa:3191

STRING: 9606.ENSP00000221419

UniGene: Hs.644906

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1