Purity
Greater than 90% as determined by SDS-PAGE.
Species
Homo sapiens (Human)
Expression Region
MHHHHHHYGRKKRRQRRRAEEQQPWAQYLELLFPTETLLLEWGGGGGSGFLGPAPAPAPAPA+2-218aa
Target Protein Sequence
ATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant human hypoxanthine-guanine phosphoribosyltransferase (HPRT1) is efficiently expressed in E. coli using an appropriate expression vector. The expression construct is specifically designed to encompass amino acids 2 to 218 of the human HPRT1 protein. For purification and detection purposes, the vector incorporates an N-terminal 6xHis-tag. The production process yields a highly pure recombinant HPRT1 protein, with a confirmed purity level of up to 90% through SDS-PAGE analysis. On the gel, the purified recombinant human HPRT1 protein is easily distinguishable as a distinct band, estimated to have a molecular weight of approximately 32 kDa. This high-quality recombinant HPRT1 protein serves as an invaluable tool for research, allowing for further investigations into its function and significance in various metabolic processes.