Recombinant Human Vinculin(VCL),partial

In Stock
Code CSB-RP137744h
Size US$1726Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names VCL
Uniprot No. P18206
Research Area Cell Adhesion
Alternative Names CMD1W; CMH15; Epididymis luminal protein 114; HEL114; Metavinculin; MV; MVCL; OTTHUMP00000019861; OTTHUMP00000019862; VCL; VINC; VINC_HUMAN; Vinculin
Species Homo sapiens (Human)
Source E.coli
Expression Region 2-235aa
Target Protein Sequence PVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 53.0kDa
Protein Length Partial
Tag Info N-terminal GST-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Actin filament (F-actin)-binding protein involved in cell-matrix adhesion and cell-cell adhesion. Regulates cell-surface E-cadherin expression and potentiates mechanosensing by the E-cadherin complex. May also play important roles in cell morphology and locomotion.
Gene References into Functions
  1. Vinculin is necessary to maintain the integrity of the glomerular filtration barrier by modulating podocyte foot processes and stabilizing intercellular junctions. PMID: 29241625
  2. ERalpha upregulates vinculin expression in breast cancer cells; Loss of vinculin promotes amoeboid features of cancer cells PMID: 28266545
  3. We report that polyoma small T antigen leads to upregulation of tubulin and vinculin in a time dependent manner with tubulin expression being most significantly affected. PMID: 29104053
  4. Differential phosphatidylinositol 4,5-diphosphate binding of vinculin isoforms promotes quasi-equivalent dimerization. PMID: 27503891
  5. Study used an all-heavy-atom structure-based model to study vinculin activation by talin in a high-tension context mechanically driven by F-actin, showed that vinculin activation may proceed from an intermediate state stabilized by partial talin-vinculin association. There is a low-force regime and a high-force regime where vinculin activation is dominated by two different pathways with distinct responses to force. PMID: 29045864
  6. Vinculin head-tail interaction is required on soft substrates to destabilize vinculin and talin in FAs, and to allow hMSCs branching. Another module involves paxillin and FAK, which soft substrates also destabilize, but independently of vinculin head-tail interaction. This multi-modularity may be key to allow a versatile response to complex biomechanical cues. PMID: 27169142
  7. The central role of talin and vinculin in cell adhesions suggests that the disintegration of the tissue in atherosclerosis could be partially driven by downregulation of these genes, leading to loosening of cell-ECM interactions and remodeling of the tissue. PMID: 27816808
  8. East Asian common VCL variant p.Asp841His (D841H) was associated with sudden unexplained nocturnal death syndrome (SUNDS) in the Chinese Han population. PMID: 28373245
  9. We identified mutations in VCL associated with Short segment Hirschsprung disease. Correction of this mutation in induced pluripotent stem cells using CRISPR/Cas9 editing, as well as the RET G731del mutation that causes Hirschsprung disease with total colonic aganglionosis, restored enteric neural crest cell function. PMID: 28342760
  10. This review discusses the current understanding of the roles of vinculin in cell-cell and cell-matrix adhesions. Emphasis is placed on the how vinculin is recruited, activated and regulated. [review] PMID: 28401269
  11. Study predicted the structure of the MAPK1-vinculin binding interface using a combination of flexible docking and molecular dynamics simulations, and confirmed that the MAPK1-vinculin interaction is mechanically regulated, and implicated a change in the vinculin D3-D4 cleft size upon vinculin activation as the basis for the conformational selectivity of MAPK1 binding toward open vinculin. PMID: 28494959
  12. These results suggest that vinculin promotes the nuclear localization of transcription factor TAZ to inhibit the adipocyte differentiation on rigid extracellular matrix. PMID: 28115535
  13. The VCL-encoding protein was involved in cardiomyopathy that associated with hypertension, therefore our results suggest the rs4746172 of VCL may be a novel target for clinical interventions to reduce CVD risk by regulating blood pressure in male Chinese PMID: 26487440
  14. Three novel genes were identified as recurrently mutated; MYCN, MYO5B and VCL, and mutations in these genes were exclusively found in malignant sympathetic paraganglioma tumors. PMID: 26650627
  15. roles and mechanisms of phospholipids in regulating the structure and function of vinculin and of its muscle-specific metavinculin splice variant. PMID: 26728462
  16. Upon actin engagement, the N-terminal "strap" and helix 1 are displaced from the vinculin tail helical bundle to mediate actin bundling. PMID: 26493222
  17. This study defined a plastic relationship between vinculin-mediated tension and adhesion complex area that controls fundamental cell-matrix adhesion properties. PMID: 26109125
  18. Analysis showed that ITGB4 and VCL were upregulated in exosomes derived from taxane-resistant prostate cancer cells suggesting them as useful markers for progression of prostate cancer associated with taxane-resistance. PMID: 25997717
  19. vinculin, present in the joints of anti-citrullinated protein antibody (ACPA)(+) rheumatoid arthritis patients, was identified as an autoantigen targeted by ACPA and CD4(+) T cells. PMID: 25942574
  20. The activation of vinculin by stretched talin induces a positive feedback that reinforces the actin-talin-vinculin association. PMID: 24452080
  21. Data indicate that specific protein interactions are spatially segregated within focal adhesions (FAs) at the nanoscale to regulate vinculin activation and function. PMID: 26053221
  22. Vinculin expression was found to be significantly downregulated. PMID: 25496021
  23. Our NMR and ITC data indicate that the SH3a and SH3b domains of CAP simultaneously bind to a long proline-rich region of vinculin with different binding specificities PMID: 24878663
  24. PIP2 binding is required for the control of vinculin dynamics and turnover in focal adhesions. PMID: 25488920
  25. Vinculin was identified as a potential plasma biomarker for age-related macular degeneration. PMID: 25298412
  26. vinculin negatively regulates malignant phenotype of tumor cells including MT1-MMP transcription through MEK/ERK pathway PMID: 25449281
  27. Vinculin is a new marker for atherosclerosis. PMID: 24369271
  28. Data indicate the role of vinculin in inducing the talin mediated integrin activation. PMID: 24446374
  29. vinculin binds to Rab5 and is required for Staphylococcus aureus uptake in cells. PMID: 24466349
  30. Case Report: VCL-ALK gene fusion in renal cell carcinoma in patient with sickle cell trait. PMID: 24698962
  31. These data reveal an unexpected regulatory mechanism in which vinculin Y822 phosphorylation determines whether cadherins transmit force and provides a paradigm for how a shared component of adhesions can produce biologically distinct functions. PMID: 24751539
  32. p38 mitogen-activated protein kinase interacts with vinculin at focal adhesions during fatty acid-stimulated cell adhesion. PMID: 24219282
  33. These results indicate that mechanical forces loaded to focal adhesions (FAs) facilitate vinculin binding to talin at FAs. PMID: 24452377
  34. this study elucidated how tensile forces generated by single stress fibers are temporally and spatially distributed to vinculin mechanosensors located within cell-matrix adhesions PMID: 23687380
  35. Data indicate that lasp-2 interacts with the focal adhesion proteins vinculin and paxillin. PMID: 23389630
  36. VAX1 rs10787760, rs6585429 and rs1871345 polymorphisms may be involved in nonsyndromic cleft lip with or without cleft palate in Brazilian patients, but there is no association with polymorphisms in FGF12, VCL, or CX43 PMID: 23679094
  37. Vinculin protein level in SW620 was much higher than that in SW480 cells. PMID: 23627409
  38. Studies indicate that that vinculin not only bundles actin filaments but can also cap these filaments and promote actin polymerization. PMID: 23466368
  39. these data suggest that metavinculin enrichment in attachment sites of muscle cells leads to higher mechanical stability of adhesion complexes allowing for greater shear force resistance. PMID: 23159629
  40. Western blotting demonstrated that vinculin was predominantly expressed in the pancreatic cancer tissues compared with non-cancerous tissues; findings indicate that vinculin may be a clinically useful biomarker of pancreatic cancer PMID: 22940724
  41. These binding assays show that raver1 forms a ternary complex with metavinculin and vinculin mRNA. PMID: 22709580
  42. The metavinculin promoted severing of actin filaments, most efficiently at substoichiometric concentrations. PMID: 22613835
  43. binding studies suggest that vinculin must be in an activated state to bind to alpha-catenin and that this interaction is stabilized by the formation of a ternary alpha-catenin-vinculin-F-actin complex, which can be formed via the F-actin binding domain PMID: 22493458
  44. Results implicate Vinculin-dependent VE-cadherin mechanosensing in endothelial processes such as leukocyte extravasation and angiogenesis. PMID: 22391038
  45. Data show that SGK1 regulates cell migration via vinculin dephosphorylation, a mechanism that is controlled by membrane androgen receptor function. PMID: 22309306
  46. alpha-catenin employs a novel mechanism to activate vinculin and may explain how vinculin is differentially recruited and/or activated in cell-cell and cell-matrix adhesions. PMID: 22235119
  47. sca4 activates vinculin and interacts with the actin cytoskeleton; vinculin has roles in Rickettsia pathogenesis PMID: 21841197
  48. VCL is expressed differently in benign prostatic hyperplasia and prostate cancer, which may serve as an indicator for the differential diagnosis of benign and malignant prostate diseases. PMID: 21171262
  49. When myosin II contractility was inhibited, the k(off) values for all three proteins changed rapidly, in a highly protein-specific manner: dissociation of vinculin from FAs was facilitated, whereas dissociation of paxillin and zyxin was attenuated. PMID: 21486952
  50. Talin-1 and vinculin negatively affect tyrosine phosphorylation of paxillin, a novel positive regulator of HIV-1 infection, and impose an early block to infection by distinct retroviruses. PMID: 21763488
  51. IpaA-directed mimicry of talin in activating vinculin occurs through three high affinity VBSs that are essential for Shigella pathogenesis. PMID: 21525010
  52. This review discusses the general function of vinculin/metavinulin as well as talin 1 and talin 2, with emphasis on what is understood about their role in the cardiac myocyte and in whole heart. PMID: 19952892
  53. The data identify the kidney as a new organ site for ALK-associated carcinomas and VCL as a novel ALK fusion partner. PMID: 21076462
  54. A helix replacement mechanism directs metavinculin's unique functions. PMID: 20502710
  55. Focal adhesion kinase expression reduced vinculin localization to focal adhesions by 35% independently of changes in integrin binding and localization of talin and paxillin. PMID: 19883375
  56. an interaction between beta-catenin and vinculin is crucial for stabilizing E-cadherin at the cell surface PMID: 20086044
  57. Here, we report on a transient interaction between the lipid-dependent protein kinase Calpha and vinculin, an early component of these sites, during spreading of HeLa cells on collagen PMID: 11741957
  58. crystal structures of human vinculin in its inactive and talin-activated states PMID: 14702644
  59. Findings support a model in which talin binds to and activates multiple vinculin molecules to provoke rapid reorganization of the actin cytoskeleton. PMID: 15070891
  60. vinculin is tyrosine phosphorylated in platelets spread on fibrinogen, and the phosphorylation is Src kinases dependent PMID: 15229287
  61. immunohistochemistry of vinculin in alpha- and gamma-sarcoglycanopathy PMID: 15547664
  62. two head-tail interfaces cooperate to suppress activation of vinculin by talin PMID: 15728584
  63. Beyond providing direct evidence that vinculin is activated at focal adhesions, this study shows that the specific functional conformation correlates with regional cellular dynamics. PMID: 15883197
  64. A model is suggested where vinculin's Vh1 domain acts as a molecular switch that undergoes distinct structural changes provoked by talin and alpha-actinin binding in focal adhesions versus adherens junctions, respectively. PMID: 15988023
  65. Same fundamental metavinculin mutation can yield either hypertrophic or dilated cardiomyopathic phenotype, underscoring a critical role for modifier genes and/or environmental stressors in cardiac remodeling. PMID: 16236538
  66. vinculin binding to talin depends on stability of the helical bundles that make up the talin rod PMID: 16407302
  67. vinculin conformation, as modulated by the strength of HTI, directly regulates the formation and lifetime of talin-vinculin complexes in cells PMID: 16608855
  68. a vinculin missense mutation confers susceptibility to hypertrophic cardiomyopathy PMID: 16712796
  69. Vinculin is activated by virulence factor of Shigella flexneri. PMID: 16826238
  70. cardiac hypertrophy may be associated with different expression of the marker vinculin/metavinculin depending on the underlying pathophysiology PMID: 16949038
  71. Invasin IpaA subverts vinculin's functions. Shigella flexneri utilizes a remarkable level of molecular mimicry of the talin-vinculin interaction to activate vinculin. PMID: 17088427
  72. Results decribe a mechanism in which signals from the T cell receptor produce WAVE2-ARP2/3-mediated de novo actin polymerization, leading to integrin clustering and high-affinity binding through the recruitment of vinculin and talin. PMID: 17591693
  73. vinculin plays a role in growth regulation of neuroendocrine tumors and in expression of CLD4 PMID: 17709988
  74. analysis of vinculin binding in its closed conformation by a helix addition mechanism PMID: 17932491
  75. alpha-synemin, but not beta-synemin, interacts with both vinculin and metavinculin PMID: 18028034
  76. The expression of vinculin constructs with unmasked binding sites in the head and tail regions induces dramatic focal adhesion growth, which is mediated by their direct interaction with talin. PMID: 18056416
  77. A subset of the tumor-specific splicing alterations (ACTN1, CALD1, and VCL) was found in all three organs and may represent general cancer-related splicing events. PMID: 18353764
  78. The structural and biochemical properties of the last 21 residues of the vinculin tail domain were investigated. PMID: 18554503
  79. Vinculin has a similar staining pattern in liver as CRBP-1 but additionally stains SMCs, and (myo)fibroblasts. PMID: 19052772
  80. the vinculin-talin-integrin system have a role in the transduction of mechanical force to the extracellular matrix PMID: 19148538
  81. Experiments on a nonphosphorylatable vinculin mutant construct at phosphorylation site tyr1065 confirmed the direct interplay between phosphorylation and exchange dynamics of adhesion proteins during adhesion site maturation. PMID: 19422016

Show More

Hide All

Involvement in disease Cardiomyopathy, dilated 1W (CMD1W); Cardiomyopathy, familial hypertrophic 15 (CMH15)
Subcellular Location Cell membrane, Peripheral membrane protein, Cytoplasmic side, Cell junction, adherens junction, Cell junction, focal adhesion, Cytoplasm, cytoskeleton, Cell membrane, sarcolemma, Peripheral membrane protein, Cytoplasmic side
Protein Families Vinculin/alpha-catenin family
Tissue Specificity Metavinculin is muscle-specific.
Database Links

HGNC: 12665

OMIM: 193065

KEGG: hsa:7414

STRING: 9606.ENSP00000211998

UniGene: Hs.643896

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1