Recombinant Mouse Cathepsin L1 (Ctsl1), partial

In Stock
Code CSB-EP006193MO
MSDS
Size $306
Order now
Image
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP006193MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctsl.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP006193MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctsl.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Ctsl
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Ctsl; Ctsl1Cathepsin L1; EC 3.4.22.15; Cathepsin L; Major excreted protein; MEP; p39 cysteine proteinase) [Cleaved into: Cathepsin L1 heavy chain; Cathepsin L1 light chain]
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
114-288aa
Target Protein Sequence
IPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGT
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
26.2 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-taggedand C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Expand your research horizon with our Recombinant Mouse Ctsl, also known as Procathepsin L or Cathepsin L1. As a key player in signal transduction, this protein offers a window into the intricate network of cellular communications. Recombinantly produced in E.coli, it stands as an essential asset for your experimental inquiries.

The protein exhibits a partial length (114-288aa) and is expressed with a dual tag: N-terminal 6xHis-tag and C-terminal Myc-tag, which ensure its efficient purification and high stability. With a purity greater than 85% as determined by SDS-PAGE, our Recombinant Mouse Ctsl meets the demands of scientific rigor. You have the flexibility to choose between a liquid form or a lyophilized powder, depending on your research needs and workflow.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

We are interested in C. Please quote 1mg of the product. And also "are there any other Cathepin L1s?"

A:
Thanks for your inquiry.
Recommendation for Cathepin L1s
Reference:
https://www.cusabio.com/index.php?m=search&c=index&a=init&dosubmit=1&catid=19&typeid=&siteid=1&q=Cathepsin%20L1&t=&s=&sa=&mk=
1)Species: We could also provide Human Mouse Rat Cat Bovine Chicken Dog Sheep Sus scrofa Chlorocebus aethiops ;
2)Isoform: Cathepsin L1 heavy chain;
3)Expression region:Recombinant Rat Cathepsin L1(Ctsl1) is Procathepsin L (18 – 334aa);

Target Background

Function
Thiol protease important for the overall degradation of proteins in lysosomes (Probable). Involved in the solubilization of cross-linked TG/thyroglobulin and in the subsequent release of thyroid hormone thyroxine (T4) by limited proteolysis of TG/thyroglobulin in the thyroid follicle lumen. In neuroendocrine chromaffin cells secretory vesicles, catalyzes the prohormone proenkephalin processing to the active enkephalin peptide neurotransmitter. In thymus, regulates CD4(+) T cell positive selection by generating the major histocompatibility complex class II (MHCII) bound peptide ligands presented by cortical thymic epithelial cells. Also mediates invariant chain processing in cortical thymic epithelial cells. Major elastin-degrading enzyme at neutral pH. Accumulates as a mature and active enzyme in the extracellular space of antigen presenting cells (APCs) to regulate degradation of the extracellular matrix in the course of inflammation. Secreted form generates endostatin from COL18A1. Critical for cardiac morphology and function. Plays an important role in hair follicle morphogenesis and cycling, as well as epidermal differentiation. Required for maximal stimulation of steroidogenesis by TIMP1.
Gene References into Functions
  1. findings suggest that CTSL contributes to the proliferation and metastasis of breast cancer and might be a potent molecular target for breast cancer treatment PMID: 26639231
  2. causally involved in the pathogenesis of experimental diabetic nephropathy PMID: 27575559
  3. findings suggest that single chain-cathepsin L is biologically active in promoting Th17 generation and is counter-regulated by serpinB1 and secondarily by asparagine endopeptidase. PMID: 26343333
  4. CTSL plays an important role in the MHC class II-mediated peptide presentation in thymic epithelial cells, acting both in the invariant chain degradation and in the generation of MHC class II-bound peptide ligands presented by cortical thymic epithelial cells. Consequently, CTSL plays an important role in the positive selection of CD4+ T cell in thymus. PMID: 11119260
  5. genetic blockade of cathepsin L activity is inferred to retard Myc-driven tumor growth, encouraging the potential utility of pharmacological inhibitors of cysteine cathepsins in treating late stage tumors. PMID: 25927437
  6. The phenotypes of cathepsin L deficiency can be fully assigned to lack of canonically targeted cathepsin L, while the biogenesis and functionality of nucleo-cytosolic cathepsin L remain elusive. PMID: 25222295
  7. in vivo functional evidence for overexpressed CTSL as a promoter of lung metastasis, whereas high CTSL levels are maintained during tumor progression due to stress-resistant mRNA translation. PMID: 25957406
  8. cathepsin L has a protective role in mouse skin carcinogenesis PMID: 21538579
  9. Cathepsin L is involved in nociception in mice, whereas peripheral autophagy and cathepsin L contribute, at least in part, to the antinociceptive effect of dimethoxybenzylidene in mice. PMID: 23912553
  10. a degradative Ctsl-MMP-2 axis, resulting in increased MMP-2 levels upon cathepsin deficiency with subsequent degradation of secreted proteins such as collagen alpha-1 (I). PMID: 23811845
  11. Cathepsin L protects mice from mycoplasmal infection and is essential for airway lymphangiogenesis. PMID: 23600672
  12. B-cell lymphopoiesis is regulated by cathepsin L. PMID: 23585893
  13. Lysosomal CTSL attenuates cardiac hypertrophy and preserves cardiac function through facilitation of autophagy and proteasomal protein processing. PMID: 23608608
  14. Two new thyroiditogenic thyroglobulin (Tg)epitopes are located near cathepsin L cleavage sites, clustered close to known immunopathogenic Tg epitopes. PMID: 23315080
  15. Bushen tiaojing recipe and xiaoyao pill promoted ovulation by enhancing the expression of CatL. PMID: 21434350
  16. Cathepsins L and Z are critical in degrading polyglutamine-containing proteins within lysosomes. PMID: 22451661
  17. Cathepsin L contributes to abdominal aortic aneurysms formation by promoting lesion inflammatory cell accumulation, angiogenesis, and protease expression. PMID: 21868704
  18. Cathepsin L deficiency affects, albeit in a limited manner, the abundances of extracellular matrix (ECM) components, signaling proteins, and further proteases as well as endogenous protease inhibitors. PMID: 21972973
  19. Defects in DNA repair associated with 53BP1 deficiency upon loss of A-type lamins are due to upregulation of CTSL. PMID: 21750527
  20. Cathepsin L deficiency significantly reduced lung granuloma number in a mouse model of sarcoidosis. PMID: 21251246
  21. CTSL regulates cardiac repair and remodelling post-myocardial infarction through a mechanism with multiple pathways. PMID: 21147810
  22. Downregulation of cathepsin L prevents autoimmune diabetes via suppression of CD8(+) T cell activity. PMID: 20877570
  23. Data from studies using embryonic cells from Ctsl knockout mice confirm Ctsl as a major protease involved in turnover of phagosomes/lysosomes. PMID: 20536383
  24. Granule-bound cathepsins are essential for processing perforin to its active form, and that CatL is an important, but not exclusive, participant in this process. PMID: 20497254
  25. cathepsin L expressed in endothelial progenitor cells plays a critical role in intraocular angiogenesis PMID: 20304958
  26. conclude that a tightly regulated balance between cathepsin L and cystatin M/E is essential for tissue integrity in epidermis, hair follicles, and corneal epithelium PMID: 20495178
  27. NOD knock-out mice exhibit complete resistance to diabetes PMID: 19664906
  28. These results demonstrate a prominent role for cathepsin L, jointly with PC1/3 and PC2, for production of dynorphins in brain. PMID: 19837164
  29. Data suggest that Ctsl is critical for the termination of growth factor signaling in the endosomal/lysosomal compartment of keratinocytes and, therefore, functions as an anti-tumor protease. PMID: 20023699
  30. In mouse models of pancreatitis, absence of cathepsin L induces apoptosis and reduces disease severity. PMID: 19900452
  31. Results suggest that cathepsin L functions as a major protease responsible for CCK8 production in mouse brain cortex, and participates with PC1/3 for CCK8 production in pituitary cells. PMID: 19589362
  32. For a subset of antigens, epitope generation is critically regulated by cathepsin L, which participates in antigen processing and generates qualitative and quantitative differences in the peptide repertoires displayed by MHC class II molecules. PMID: 11884425
  33. An alternate targeting pathway for procathepsin L in mouse fibroblasts PMID: 11929604
  34. Dilated cardiomyopathy in mice deficient for the lysosomal cysteine peptidase cathepsin L. PMID: 11972068
  35. cathepsin L is the primary mediator of reovirus disassembly PMID: 11986312
  36. Cathepsin L regulates CD4+ T cell selection independently of its effect on invariant chain: a role in the generation of positively selecting peptide ligands PMID: 12021314
  37. mice lacking cathepsin L have neuronal loss and brain atrophy; demonstrates pivotal role in maintenance of the central nervous system PMID: 12048238
  38. shows evolution in placental expression by gene duplication PMID: 12054558
  39. cathepsin L plays a critical role in hair follicle morphogenesis and cycling, as well as epidermal differentiation PMID: 12163394
  40. regulation of the phagosomal CatL, CatB, CatS ans CatZ contents during dendritic cell activation PMID: 12186844
  41. Studies of thymocytes from knockout mice demonstrate a specific role for catL in regulating presentation of natural CD1d ligands mediating V(alpha)14(+)NK1.1(+) T cell selection. PMID: 12368909
  42. major histocompatibility complex class II-associated invariant chain controls the activity of extracellular cathepsin L PMID: 12417635
  43. Data show that impaired cathepsin-L function may lead to the establishment of gingival overgrowth as seen in patients treated with calcium antagonists. PMID: 12466121
  44. Prevents atrophy of seminiferous tubules and promotes the formation of preleptotene spermatocytes and the differentiation of these meiotic cells into pachytene spermatocytes. PMID: 12533435
  45. cathepsin L plays a regulatory role early in the process of mammary gland involution PMID: 12815617
  46. Cathepsin L has an previously uncharacterized biological role in the production of [Met]enkephalin, an endogenous peptide neurotransmitter PMID: 12869695
  47. muscle cathepsin L gene expression is increased in diabetes-prone mice and related to glucose tolerance. PMID: 12941783
  48. A cathepsin L isoform devoid of a signal peptide loalizes to the nucleus in S phase and processes the CDP/Cux transcription factor. PMID: 15099520
  49. cathepsin L and alpha(3) integrin have roles in podocyte migration PMID: 15197181
  50. Data suggest that cathepsin L has a critical role in the integration of circulating endothelial progenitor cells (EPC) into ischemic tissue and is required for EPC-mediated neovascularization. PMID: 15665831

Show More

Hide All

Subcellular Location
Lysosome. Apical cell membrane; Peripheral membrane protein; Extracellular side. Secreted, extracellular space. Secreted. Cytoplasmic vesicle, secretory vesicle, chromaffin granule.
Protein Families
Peptidase C1 family
Tissue Specificity
Expressed in thymus, kidney and liver. Expressed in thyroid epithelial cells. Expressed in cortical thymic epithelial cells. Expressed by antigen presenting cells (APCs) such as dendritic cells and macrophages.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*