Recombinant Mouse Frataxin,mitochondrial(Fxn)

In Stock
Code CSB-EP009086MOa0
Product Type Recombinant Protein
Size US$2466
Uniprot No. O35943
Lead Time 3-7 business days
Relevance Promotes the biosynthesis of he and assbly and repair of iron-sulfur clusters by delivering Fe2+ to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe2+ to Fe3+; the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization. Modulates the RNA-binding activity of ACO1 .
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence LGTLDNPSSLDETAYERLAEETLDSLAEFFEDLADKPYTLEDYDVSFGDGVLTIKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLARELTKALNTKLDLSSLAYSGKGT
Research Area Others
Source E.coli
Gene Names Fxn
Expression Region 78-207aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 19.9 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe(2+) to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe(2+) to Fe(3+); the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization. Modulates the RNA-binding activity of ACO1 (By similarity).
Subcellular Location Cytoplasm, cytosol, Mitochondrion
Protein Families Frataxin family
Tissue Specificity Heart, liver, skeletal muscle, kidney, spleen and thymus. Weakly expressed in the brain and lung.
Database Links

KEGG: mmu:14297

STRING: 10090.ENSMUSP00000080081

UniGene: Mm.7319

Related Products

Fxn Antibodies

Fxn Antibodies for Mouse

Fxn Antibodies for Mus musculus (Mouse)

Fxn Proteins

Fxn Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.