Recombinant Mouse Frataxin,mitochondrial (Fxn), partial

In Stock
Code CSB-EP009086MOa0
Abbreviation Recombinant Mouse Fxn protein, partial
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Fxn; FrdaFrataxin; mitochondrial; Fxn; EC 1.16.3.1) [Cleaved into: Frataxin intermediate form; Frataxin mature form]
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
78-207aa
Target Protein Sequence
LGTLDNPSSLDETAYERLAEETLDSLAEFFEDLADKPYTLEDYDVSFGDGVLTIKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLARELTKALNTKLDLSSLAYSGKGT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
19.9 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe(2+) to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe(2+) to Fe(3+); the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization. Modulates the RNA-binding activity of ACO1.
Gene References into Functions
  1. This study demonstrated that mouse model of Friedreich's ataxia showed that decreased grip strength endurance time , threshold of peripheral sensitivity using Von Frey monofilaments and gait parameters. PMID: 27575947
  2. Here, the authors show that loss of Fxn in the nervous system in mice also activates an iron/sphingolipid/PDK1/Mef2 pathway, indicating that the mechanism is evolutionarily conserved. PMID: 27901468
  3. The in vitro antioxidant treatments trigger the axonal re-growth and the increase in stable MTs in shFxn, thus contributing to identify new neuronal targets of oxidation in this disease and providing a novel approach for antioxidant therapies. PMID: 27516386
  4. Retinal FXN levels are increased in response to ischemia. Furthermore, elevated FXN levels had a clear neuroprotective effect as shown by increased ganglion cell survival after acute retinal ischemia/reperfusion. Frataxin's neuroprotective effect was associated with an upregulation of antioxidative enzymes. PMID: 27537261
  5. Frataxin Deficiency Promotes Excess Microglial DNA Damage and Inflammation that Is Rescued by PJ34 PMID: 26954031
  6. Frataxin-deficient mice, which had higher mitochondrial iron loading, showed impaired airway mucociliary clearance and higher pulmonary inflammation at baseline. PMID: 26752519
  7. Using a mouse model of hepatic FXN deficiency in combination with mice deficient for IRP1, a key regulator of cellular iron metabolism, we show that IRP1 activation in conditions of Fe-S deficiency increases the available cytosolic labile iron pool PMID: 25651183
  8. The Fxn KO/Mck mice tested from one to two months of age showed abnormal gait patterns accompanied by a loss in motor skills PMID: 25765157
  9. Reduced expression of frataxin in Friedreich's ataxia leads to elevation of COX2-mediated oxylipin synthesis stimulated by increases in transcription factors that respond to increased reactive oxygen species. PMID: 25104852
  10. Frataxin-deficient cells showed a specific inhibition of mitochondrial Complex I activity already at 70% residual frataxin levels, whereas the glutathione imbalance progressively increased after silencing. PMID: 24714088
  11. The results support a mechanistic hypothesis in which frataxin deficiency decreases Nrf2 expression in vivo, causing the sensitivity to oxidative stress in target tissues the DRG and the cerebella, which contributes to the process of neurodegeneration. PMID: 23350650
  12. rescue of the Friedreich ataxia knockout mutation in transgenic mice containing an FXN-EGFP genomic reporter PMID: 24667739
  13. these results indicate that IGF-I exerts cell-context neuroprotection in frataxin deficiency that maybe therapeutically effective. PMID: 23039828
  14. Data show that the respiratory chain defects accompanying frataxin deficiency cause progressive hyperacetylation of cardiac mitochondrial proteins due to the inhibition of SIRT3 deacetylase. PMID: 22394676
  15. dual, pro-proliferative but chemosensitizing role in astrocytic tumors PMID: 21863062
  16. Distribution of frataxin in eye retina of normal mice and of transgenic R7E mice with retinal degeneration PMID: 20799613
  17. As an attempt to generate a mouse model of Friedreich ataxia, we introduced a (GAA)(230) repeat within the mouse frataxin gene by homologous recombination. PMID: 11852098
  18. studies indicate an association between frataxin deficiency, iron deposits and cardiac fibrosis, but no obvious association between iron accumulation and neurodegeneration similar to Friedreich ataxia could be detected PMID: 12880182
  19. frataxin has a role in cellular growth arrest and apoptosis, and its absence can cause experimental diabetes PMID: 12925693
  20. We have generated two mouse models for FRDA that specifically develop progressive mixed cerebellar and sensory ataxia, the most prominent neurological features of Friedreich ataxia with a slowly progressive neurological degeneration PMID: 14985441
  21. frataxin may act as a mitochondrial tumor suppressor protein PMID: 16278235
  22. The identification of a core set of genes changing early in the FRDA pathogenesis can be a useful tool in both clarifying the disease process and in evaluating new therapeutic strategies. PMID: 16442805
  23. Reduced expression of mitochondrial frataxin in mice exacerbates diet-induced obesity. PMID: 17404227
  24. The fxn GAA repeat expansion mutation induces comparable epigenetic changes in human and transgenic mouse brain and heart. PMID: 18045775
  25. loss of Fxn markedly alters cellular Fe trafficking and Fe chelation limits myocardial hypertrophy in the mutant PMID: 18621680
  26. Frataxin deficiency causes upregulation of mitochondrial Lon and ClpP proteases and severe loss of mitochondrial Fe-S proteins. PMID: 19154341
  27. The PPARG pathway is dysregulated in frataxin deficient mice and Friedreich's ataxia patients. PMID: 19376812
  28. We showed that complete absence of murine frataxin in fibroblasts inhibits cell division and leads to cell death. This lethal phenotype was rescued through transgenic expression of human wild type as well as mutant (hFXN(G130V) and hFXN(I154F)) frataxin PMID: 19629184
  29. Results enable the construction of a model explaining the cytosolic iron deficiency and mitochondrial iron loading in the absence of frataxin, which is important for understanding the pathogenesis of Friedreich's ataxia. PMID: 19805308

Show More

Hide All

Subcellular Location
Cytoplasm, cytosol. Mitochondrion. Note=PubMed:17597094 describes localization exclusively in mitochondria.
Protein Families
Frataxin family
Tissue Specificity
Heart, liver, skeletal muscle, kidney, spleen and thymus. Weakly expressed in the brain and lung.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*