Recombinant Mouse Lymphocyte antigen 6C1(Ly6c1)

In Stock
Code CSB-YP317813MOa4
Product Type Recombinant Protein
Size US$2959Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P0CW02
Lead Time 3-7 business days
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence LQCYECYGVPIETSCPAVTCRASDGFCIAQNIELIEDSQRRKLKTRQCLSFCPAGVPIRDPNIRERTSCCSEDLCNAAVPTAG
Research Area others
Source Yeast
Gene Names Ly6c1
Expression Region 27-109aa
Tag Info N-terminal 6xHis-SUMOSTAR-tagged
Mol. Weight 25.1kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Lipid-anchor, GPI-anchor
Database Links

KEGG: mmu:17067

STRING: 10090.ENSMUSP00000066954

UniGene: Mm.1583

Related Products

Ly6c1 Proteins

Ly6c1 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.