Name: Recombinant Mouse Mast cell protease 4(Mcpt4)
Brand: CUSABIO
SKU: CSB-YP325157MO

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Mcpt4

Uniprot No.

P21812

Research Area

Cell Biology

Alternative Names

Mast cell protease 4; Mcp 4; Mcpt4; MCPT4_MOUSE; MMCP 4; MMCP 4A; MMCP 4B; MMCP-4; MMCP4; MMCP4A; MMCP4B; MSMCP; Myonase; Serosal mast cell protease

Species

Mus musculus (Mouse)

Source

Yeast

Expression Region

21-246aa

Target Protein Sequence

IIGGVESRPHSRPYMAHLEITTERGFTATCGGFLITRQFVMTAAHCSGREITVTLGAHDVSKTESTQQKIKVEKQIVHPKYNFYSNLHDIMLLKLQKKAKETPSVNVIPLPRPSDFIKPGKMCRAAGWGRTGVTEPTSDTLREVKLRIMDKEACKNYWHYDYNLQVCVGSPRKKRSAYKGDSGGPLLCAGVAHGIVSYGRGDAKPPAVFTRISSYVPWINRVIKGE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

27.1kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Step up your Cell Biology research with our Recombinant Mouse Mcpt4, a protein prominently recognized as Mast cell protease 4. Expressed in Yeast, this protein plays a crucial part in various cellular functions and immune responses.

Our Mcpt4 protein is the full length of the mature protein (21-246aa), which comprises the complete structure of this notable molecule. It comes with a convenient N-terminal 6xHis tag, facilitating its purification and detection. With a purity greater than 90% as determined by SDS-PAGE, you can be confident of its quality and performance in your research. Choose between a liquid form for immediate use or a lyophilized powder for long-term storage, as per your needs.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

I requested for the following information. Kindly provide assistance CSB-YP325157MO, Recombinant Mouse Mast cell protease 4(Mcpt4)
1.Availability of 200 ug size and delivery lead time
2.Is the product biologically active?
3.Price of 200 ug

Very nice to receive your inquiry.
Name: Recombinant Mouse Mast cell protease 4(Mcpt4)
Expression Region: 21-246aa; Full Length of Mature Protein
Tag Info: N-terminal 6xHis-tagged
Expression Sequence:

Product Type: Developed Recombinant Protein
Biological Activity: We haven't tested its activity yet so we can't 100% guarantee that it is active. The protein we provide is full length of mature protein purified under mild conditions, which should have activity
in theory.
Packing Size: If you want to purchase 200ug, we suggest to deliver Lyophilized Powder packed into 100ug*2 vials.

Target Background

Function

Has chymotrypsin-like activity. Hydrolyzes the amide bonds of synthetic substrates having Tyr and Phe residues at the P1 position. Preferentially hydrolyzes the 'Tyr-4-|-Ile-5' bond of angiotensin I and the 'Phe-20-|-Ala-21' bond of amyloid beta-protein, and is less active towards the 'Phe-8-|-His-9' bond of angiotensin I and the 'Phe-4-|-Ala-5' and 'Tyr-10-|-Glu-11' bonds of amyloid beta-protein. Involved in thrombin regulation and fibronectin processing.

Gene References into Functions

deletion of the gene encoding MMCP-4 (Mcpt4), markedly reduced late, but not early, infarct size by suppressing IGF-1 degradation and, consequently, diminished cardiac dysfunction and adverse structural remodeling PMID: 27274047
study supports a role for mMCP-4 in the early inflammatory phases of the disease in a mouse model of MS. PMID: 27610007
These results suggest that the inhibition of mMCP-4 reduces lesion spreading in the earlier phases of atherosclerosis development and can help stabilise the more advanced plaque PMID: 26976326
Results suggest that mouse mast cell proteases 4, 5, and 6 are mediators of the critical role mast cells play in microdeformational wound therapy in the proliferative phase of healing. PMID: 24814421
Data indicate that a second-degree burn injury can initiate an immediate novel zonal degranulation of mast cell throughout all skin layers and a disruption of the epidermal tight junctions dependent on the nonredundant presence of mMCP4 and mMCP5. PMID: 24523504
these results support the conclusion that mast cells can contribute to the initial lung injury induced by bleomycin through release of the MCPT4 chymase. PMID: 24453258
knock-outs demonstrate elevated airway reactivity and eosinophilia, and higher levels of serum immunoglobulin E PMID: 23235745
Mast cell chymase degrades the alarmins heat shock protein 70, biglycan, HMGB1, and interleukin-33 (IL-33) and limits danger-induced inflammation. PMID: 24257755
Mast cell released mMCP4 has anti-fibrotic potential in acutely induced obstructive nephropathy. PMID: 23515052
Data from Mcp-4 (mast cell protease 4) knockout mice suggest Mcp-4 plays a pivotal role in the dynamic (in vivo and in vitro) conversion of systemic Big-endothelin-1 to endothelin-1 (1-31). PMID: 23596057
MCs exert protective functions after trauma, at least in part via mMCP-4, by suppressing exacerbated inflammation via their proteases. PMID: 23193170
The effects of interactions between mMCP-4 and TNF in vivo by analyzing the features of a classic model of polymicrobial sepsis, were assessed. PMID: 22901752
mMCP-4 plays two different roles in the pathogenesis of experimental BP, by both activating MMP-9 and by cleaving BP180, leading to injury of the hemidesmosomes and extracellular matrix of the basement membrane zone. PMID: 21880713
mMCP-4-deficient mice but not to mMCP-5-deficient mice revealing nonredundant actions for these two MC proteases in a model of innate inflammatory injury with remodeling. PMID: 21076070
MCP-4 contributes locally to the aggravation of glomerulonephritis by mediating a variety of proinflammatory effects. PMID: 20530261
mice deficient in mast cells (Kit(W-sh/W-sh) [Wsh]) or mast cell chymase (Mcpt4(-/-)) have significantly decreased basal small intestinal permeability compared with wild-type (WT) mice PMID: 20018751
localization in skeletal muscle myofibrils PMID: 12204111
Data describe a mouse strain with a targeted deletion in the gene for mast cell protease 4 (mMCP-4), in terms of tissue localization and functional properties. PMID: 12900518
mast cell mMCP-4, -5, and -6 (chymase and tryptase) participate in the acute inflammation and remodeling process of viral myocarditis. PMID: 14578624
mast cell chymase and CPA have key roles in both the generation and degradation of Ang II PMID: 15173164
key role for mast cell chymase in the regulation of pro-MMP-2 and -9 activities (mast cell chymase AND pro-mmp-2 AND -9) PMID: 15615702
Mast cell protease 4 reduces the antibody response and the severity of disease in autoimmune arthritis. PMID: 19010978
abdominal aortic aneurysm lesions in Mcpt4(-/-) mice had fewer inflammatory cells and less apoptosis, angiogenesis, and elastin fragmentation than those of WT mice PMID: 19720934
chymase (MCP-4) present in the upper airways protects against allergic airway responses, possibly by regulating smooth muscle cells. PMID: 19841188

Hide All

Protein Families

Peptidase S1 family, Granzyme subfamily

Tissue Specificity

Submucosal mast cells. In femoral muscle, detected in myocytes but not in mast cells.

Database Links

KEGG: mmu:17227

STRING: 10090.ENSMUSP00000038103

UniGene: Mm.439684

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：

Code	CSB-YP325157MO
Size	US$368
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Mast cell protease 4(Mcpt4)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage