Code | CSB-YP325157MO |
MSDS | |
Size | $368 |
Order now | |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Step up your Cell Biology research with our Recombinant Mouse Mcpt4, a protein prominently recognized as Mast cell protease 4. Expressed in Yeast, this protein plays a crucial part in various cellular functions and immune responses.
Our Mcpt4 protein is the full length of the mature protein (21-246aa), which comprises the complete structure of this notable molecule. It comes with a convenient N-terminal 6xHis tag, facilitating its purification and detection. With a purity greater than 90% as determined by SDS-PAGE, you can be confident of its quality and performance in your research. Choose between a liquid form for immediate use or a lyophilized powder for long-term storage, as per your needs.
There are currently no reviews for this product.
I requested for the following information. Kindly provide assistance CSB-YP325157MO, Recombinant Mouse Mast cell protease 4(Mcpt4)
1.Availability of 200 ug size and delivery lead time
2.Is the product biologically active?
3.Price of 200 ug
IIGGVESRPHSRPYMAHLEITTERGFTATCGGFLITRQFVMTAAHCSGREITVTLGAHDVSKTESTQQKIKVEKQIVHPKYNFYSNLHDIMLLKLQKKAKETPSVNVIPLPRPSDFIKPGKMCRAAGWGRTGVTEPTSDTLREVKLRIMDKEACKNYWHYDYNLQVCVGSPRKKRSAYKGDSGGPLLCAGVAHGIVSYGRGDAKPPAVFTRISSYVPWINRVIKGE