Recombinant Mouse Mast cell protease 4 (Mcpt4)

In Stock
Code CSB-EP325157MO
Abbreviation Recombinant Mouse Mcpt4 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Mcpt4
Uniprot No.
Research Area
Others
Alternative Names
Mast cell protease 4; Mcp 4; Mcpt4; MCPT4_MOUSE; MMCP 4; MMCP 4A; MMCP 4B; MMCP-4; MMCP4; MMCP4A; MMCP4B; MSMCP; Myonase; Serosal mast cell protease
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
21-246aa
Target Protein Sequence
IIGGVESRPHSRPYMAHLEITTERGFTATCGGFLITRQFVMTAAHCSGREITVTLGAHDVSKTESTQQKIKVEKQIVHPKYNFYSNLHDIMLLKLQKKAKETPSVNVIPLPRPSDFIKPGKMCRAAGWGRTGVTEPTSDTLREVKLRIMDKEACKNYWHYDYNLQVCVGSPRKKRSAYKGDSGGPLLCAGVAHGIVSYGRGDAKPPAVFTRISSYVPWINRVIKGE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
29.1kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The preparation of Recombinant Mouse Mcpt4 protein included 3 main steps: construct the expression vector, expression of protein of interest, and protein purification. Every step was performed under a strict QC system so that we got the premium protein. This Mcpt4 was expressed in E.coli at and fused with N-terminal 6xHis tag. According to SDS-PAGE, the purity turns out to be 90%+.

Mcpt4 is the chymase mouse mast cell protease 4. MCPT4-deficient mice had worsened kidney function compared to wildtype mice. MCPT4 absence exacerbated pathologic neutrophil infiltration in the kidney and increased kidney myeloperoxidase expression, cell death and necrosis. Besides, studies revealed that MCPT4 Chymase Promote Renal Impairment after partial ureteral obstruction. Among the murine chymases, MCPT4 is most likely the functional counterpart of the unique human chymase because it has similar substrate specificity, tissue distribution, proteoglycan-binding properties, and ability to convert angiotensin (Ang) I into Ang II. A study found that mast cell can significantly contribute to the development of UPJ pathology. This action is at least partially mediated by released MCPT4 chymase.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

About Mcpt4 Recombinant Protein (CSB-EP325157MO), we have some questions:
1. What is the format of MCPT4 enzyme? Is it a MCPT4 precursor format, or a matured MCPT4 protein?
2. What are the prices for the different prices? Kindly provide the lead time.

A:
Very nice to receive your inquiry.
1. This is a matured MCPT4 protein.
2. Lead Time: 15-20 working days

Target Background

Function
Has chymotrypsin-like activity. Hydrolyzes the amide bonds of synthetic substrates having Tyr and Phe residues at the P1 position. Preferentially hydrolyzes the 'Tyr-4-|-Ile-5' bond of angiotensin I and the 'Phe-20-|-Ala-21' bond of amyloid beta-protein, and is less active towards the 'Phe-8-|-His-9' bond of angiotensin I and the 'Phe-4-|-Ala-5' and 'Tyr-10-|-Glu-11' bonds of amyloid beta-protein. Involved in thrombin regulation and fibronectin processing.
Gene References into Functions
  1. deletion of the gene encoding MMCP-4 (Mcpt4), markedly reduced late, but not early, infarct size by suppressing IGF-1 degradation and, consequently, diminished cardiac dysfunction and adverse structural remodeling PMID: 27274047
  2. study supports a role for mMCP-4 in the early inflammatory phases of the disease in a mouse model of MS. PMID: 27610007
  3. These results suggest that the inhibition of mMCP-4 reduces lesion spreading in the earlier phases of atherosclerosis development and can help stabilise the more advanced plaque PMID: 26976326
  4. Results suggest that mouse mast cell proteases 4, 5, and 6 are mediators of the critical role mast cells play in microdeformational wound therapy in the proliferative phase of healing. PMID: 24814421
  5. Data indicate that a second-degree burn injury can initiate an immediate novel zonal degranulation of mast cell throughout all skin layers and a disruption of the epidermal tight junctions dependent on the nonredundant presence of mMCP4 and mMCP5. PMID: 24523504
  6. these results support the conclusion that mast cells can contribute to the initial lung injury induced by bleomycin through release of the MCPT4 chymase. PMID: 24453258
  7. knock-outs demonstrate elevated airway reactivity and eosinophilia, and higher levels of serum immunoglobulin E PMID: 23235745
  8. Mast cell chymase degrades the alarmins heat shock protein 70, biglycan, HMGB1, and interleukin-33 (IL-33) and limits danger-induced inflammation. PMID: 24257755
  9. Mast cell released mMCP4 has anti-fibrotic potential in acutely induced obstructive nephropathy. PMID: 23515052
  10. Data from Mcp-4 (mast cell protease 4) knockout mice suggest Mcp-4 plays a pivotal role in the dynamic (in vivo and in vitro) conversion of systemic Big-endothelin-1 to endothelin-1 (1-31). PMID: 23596057
  11. MCs exert protective functions after trauma, at least in part via mMCP-4, by suppressing exacerbated inflammation via their proteases. PMID: 23193170
  12. The effects of interactions between mMCP-4 and TNF in vivo by analyzing the features of a classic model of polymicrobial sepsis, were assessed. PMID: 22901752
  13. mMCP-4 plays two different roles in the pathogenesis of experimental BP, by both activating MMP-9 and by cleaving BP180, leading to injury of the hemidesmosomes and extracellular matrix of the basement membrane zone. PMID: 21880713
  14. mMCP-4-deficient mice but not to mMCP-5-deficient mice revealing nonredundant actions for these two MC proteases in a model of innate inflammatory injury with remodeling. PMID: 21076070
  15. MCP-4 contributes locally to the aggravation of glomerulonephritis by mediating a variety of proinflammatory effects. PMID: 20530261
  16. mice deficient in mast cells (Kit(W-sh/W-sh) [Wsh]) or mast cell chymase (Mcpt4(-/-)) have significantly decreased basal small intestinal permeability compared with wild-type (WT) mice PMID: 20018751
  17. localization in skeletal muscle myofibrils PMID: 12204111
  18. Data describe a mouse strain with a targeted deletion in the gene for mast cell protease 4 (mMCP-4), in terms of tissue localization and functional properties. PMID: 12900518
  19. mast cell mMCP-4, -5, and -6 (chymase and tryptase) participate in the acute inflammation and remodeling process of viral myocarditis. PMID: 14578624
  20. mast cell chymase and CPA have key roles in both the generation and degradation of Ang II PMID: 15173164
  21. key role for mast cell chymase in the regulation of pro-MMP-2 and -9 activities (mast cell chymase AND pro-mmp-2 AND -9) PMID: 15615702
  22. Mast cell protease 4 reduces the antibody response and the severity of disease in autoimmune arthritis. PMID: 19010978
  23. abdominal aortic aneurysm lesions in Mcpt4(-/-) mice had fewer inflammatory cells and less apoptosis, angiogenesis, and elastin fragmentation than those of WT mice PMID: 19720934
  24. chymase (MCP-4) present in the upper airways protects against allergic airway responses, possibly by regulating smooth muscle cells. PMID: 19841188

Show More

Hide All

Protein Families
Peptidase S1 family, Granzyme subfamily
Tissue Specificity
Submucosal mast cells. In femoral muscle, detected in myocytes but not in mast cells.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*