Recombinant Mouse Mitochondrial uncoupling protein 2(Ucp2)

Code CSB-YP025555MO
Size Pls inquire other sizes
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP025555MO
Size Pls inquire other sizes
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP025555MO-B
Size Pls inquire other sizes
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP025555MO
Size Pls inquire other sizes
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP025555MO
Size Pls inquire other sizes
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity >85% (SDS-PAGE)
Target Names Ucp2
Uniprot No. P70406
Alternative Names Ucp2; Slc25a8; Mitochondrial uncoupling protein 2; UCP 2; Solute carrier family 25 member 8; UCPH
Species Mus musculus (Mouse)
Expression Region 1-309
Target Protein Sequence MVGFKATDVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGESQGLVRTAASAQYR GVLGTILTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHAGIGSRL LAGSTTGALAVAVAQPTDVVKVRFQAQARAGGGRRYQSTVEAYKTIAREEGIRGLWKGTS PNVARNAIVNCAELVTYDLIKDTLLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKT RYMNSALGQYHSAGHCALTMLRKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMA AYQSREAPF
Protein Length Full length protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Target Data

Function UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat (By similarity).
Gene References into Functions
  1. UCP2 regulates daily rhythms of insulin secretion in MIN6 cells and isolated islets from male mice. PMID: 28702331
  2. Study provides evidence that UCP2 plays a protecting role against LPS by regulating the balance between autophagy and apoptosis of cardiomyocytes, and by which mechanisms, it may contribute to homeostasis of cardiac function and cardiomyocytes activity. PMID: 29547569
  3. UCP2 inhibits myointimal hyperplasia after vascular injury, probably through suppressing nuclear factor-kappaB-dependent smooth muscle cell proliferation and migration. PMID: 29025747
  4. Upregulation of UCP2 conferred protective effects to the stressed beta-cell through mechanisms not directly associated with superoxide production. PMID: 28755631
  5. UCP2-dependent modulations have a major impact on cardiac electrophysiology. PMID: 28370799
  6. UCP2 regulates embryonic neurogenesis through reactive oxygen species-mediated Yap alternation, thus shedding new sight on mitochondrial metabolism involved in embryonic neurogenesis. PMID: 28276603
  7. Data demonstrate that UCP2 controls pancreas development through the ROS-AKT signaling pathway. PMID: 29079704
  8. UCP2 has two glycine-rich motifs, motif 1: EGIRGLWKG (170-178) and a Walker A-like motif 2: EGPRAFYKG (264-272). These motifs seem to be important for the function of UCP2. UCP2/K177E- or UCP2/G174L-expressed cells did not induce enlarged cell shapes. UCP2/K177E and UCP2/G174L produced functional incompetence of the glycine-rich motif 1. Senescent-like cells significantly decreased the mitochondrial membrane potentials. PMID: 26864036
  9. our findings reveal that UCP2 regulates inflammation responses in astrocytes and plays an important role in the pathogenesis of depression and that UCP2 may be a promising therapeutic target for depression. PMID: 27566281
  10. attenuates renal ischemia-reperfusion injury, probably by reducing cell apoptosis through protection of autophagy PMID: 28424210
  11. UCP-2 prevents angiotensin-II-induced abdominal aortic aneurysm in apolipoprotein E-knockout mice via antioxidant and antiapoptotic activities. PMID: 28683125
  12. This study demonstrating a FABP4-UCP2 axis with the potential to modulate the microglial inflammatory response. PMID: 28214555
  13. The miR-133a-UCP2 pathway participates in inflammatory bowel disease (IBD) by altering downstream inflammation, oxidative stress and markers of energy metabolism, which provides novel clues and potential therapeutic targets for IBD. PMID: 28104982
  14. PPARgamma inhibited PDGF-BB-induced ROS in VSMCs by upregulating UCP2 expression. PMID: 27144886
  15. these data offer a novel pathway whereby FABP4/aP2 regulates macrophage redox signaling and inflammasome activation via control of UCP2 expression. PMID: 27795298
  16. Ucp2 affects glutathione metabolism by regulating hepatic efflux of glutathione. Nrf2 deficiency may not aggravate oxidative stress in Ucp2-deficient mice. PMID: 27453341
  17. Induction of autophagy by SCFAs required PPARgamma stimulation of Uncoupling Protein 2 (UCP2) expression that was associated with reduced intracellular ATP levels and activation of PRKAA1/AMPK (protein kinase, AMP-activated, alpha 1 catalytic subunit). In addition, elimination of gut flora by chronic antibiotic treatment diminished basal hepatic autophagy in mice suggesting that gut microbiota can regulate hepatic auto... PMID: 27773823
  18. UCP2 induces protective effects on ROS and ATP levels during aging. Additionally, the results suggest an imbalance in hematopoiesis because of the lack of UCP2. PMID: 27544660
  19. Intriguingly, on the molecular level this acceleration in aging predominantly is accompanied by increased levels of circulating IGF-1 in Ucp2(-/-) mice, hinting at a crosstalk between UCP2 and the classical Insulin/IGF-1 signaling aging pathway. PMID: 27364833
  20. PPARbeta/PPARgamma activation restored the LPS-induced endothelial dysfunction by upregulation of UCP2, with the subsequent alleviation of ER stress and NADPH oxidase activity, thus reducing intracellular reactive oxygen species production and increasing nitric oxide bioavailability. PMID: 27179975
  21. Apart from their slower growth, pancreatic stellate cells of UCP2-/- mice displayed no functional abnormalities. PMID: 27919855
  22. In the brains of UCP2-knockout mice, there was a decrease in glutamate, glutamine and GABA. PMID: 27401256
  23. Loss of UCP2 impairs cold-induced non-shivering thermogenesis by promoting a shift toward glucose utilization in brown adipose tissue. PMID: 28130074
  24. Increased expression of UCP2 significantly reduced apoptosis during the critical developmental period resulting in elevated numbers of retinal ganglion cells in the adult. PMID: 26846222
  25. Study shows that mitochondrial location controlled by UCP2 is relevant for adaptive responses of neurons in cortical and hippocampal neurons and are relevant to perinatal hypoxia-triggered circuit adaptations PMID: 26777666
  26. Study shows that glucose load results in mitochondrial fission and reduced reactive oxygen species in ventromedial nucleus of the hypothalamus neurons mediated by dynamin-related peptide 1 (DRP1) under the control of uncoupling protein 2 (UCP2). PMID: 26919426
  27. UCP2 modulating role in mitochondrial calcium uptake PMID: 26849136
  28. Blocking UCP2 expression attenuates cardiac hypertrophy induced by pressure overload PMID: 26196155
  29. UCP2 knockout suppresses mouse skin carcinogenesis. PMID: 25784177
  30. A newly identified functional variant (rs1626521) in UCP-3 affects postprandial gastric functions and satiety and may contribute to weight gain and alter human mitochondrial function. PMID: 25755013
  31. while the lack of UCP2 has no acute effect on body temperature, UCP2 may inhibit rapid improvements in defense against cold, in contrast to UCP1, whose main function is to promote thermogenesis. PMID: 24952267
  32. high UCP2 levels allow better utilization of fatty acid oxidation resulting in a beneficial effect on mitochondrial function in heart, postponing systemic lactic acidosis and resulting in longer lifespan in these mice. PMID: 24945157
  33. Results suggest that hippocampal UCP2 is essential for cognitive function and the resistance to anxiety of mice, but not required for the beneficial effects of exercise PMID: 25003714
  34. Free fatty acid recognizes UCP2 at a peripheral site via electrostatic interaction. Flipping ionized fatty acid by UCP2 is required for UCP2-mediated H+ transport in mitochondria. PMID: 25127353
  35. long-term exposure to CT-1-CP could lead to the alteration in the expression of sarcomeric alpha-actin, alpha-actinin and mitochondrial UCP2. PMID: 25480572
  36. Therefore, SET overexpression in HEK293 cells promotes mitochondrial fission and reduces autophagic flux in apparent association with up-regulation of UCP2 and UCP3. PMID: 25656576
  37. The FABP-FFA equilibrium controls UCP2 expression. PMID: 25582199
  38. UCP2 regulates the NLRP3 inflammasome by inducing the lipid synthesis pathway in macrophages. PMID: 25574840
  39. In ApoE-knockout mice, there was a progressive reduction of UCP-2 levels and an increase in vascular damage. PMID: 25077985
  40. Knock-out of Ucp2 exacerbated salt-induced cardiovascular and renal remodeling and enhanced oxidative stress. PMID: 24833471
  41. UCP2 may act as a powerful influence on hepatic regeneration and cell death in the steatotic liver. PMID: 24320727
  42. L. donovani infection resulted in degradation of USF1 thereby facilitating SREBP2 binding which in turn assisted in the association of Sp1 with the promoter ultimately culminating in elevated transcription of UCP2. PMID: 24417972
  43. UCP2 is present in cells with highly proliferative potential, which have a glycolytic type of metabolism as a common feature, whereas UCP4 is strongly associated with non-proliferative highly differentiated neuronal cells PMID: 24523901
  44. Mitochondrial retrograde signaling mediated by UCP2 inhibits cancer cell proliferation and tumorigenesis. PMID: 24853548
  45. miR-30e/UCP2 axis has an important role in mediating TGF-beta1-induced epithelial-mesenchymal transition and kidney fibrosis. PMID: 23515048
  46. Induction of UCP2 in pulmonary macrophages is an early response to hyperoxia-associated lung injury. PMID: 23905971
  47. Mitochondrial UCP2 plays a critical role in protecting splenocytes from oxidative stress-induced apoptosis during pathogen activation. PMID: 24291389
  48. TRPV1 activation might protect against hyperglycemia-induced endothelial dysfunction through a mechanism involving the PKA/UCP2 pathway. PMID: 23607427
  49. UCP2 is upregulated in the absence of NLRP3 and ASC. PMID: 23988448
  50. Increased mitochondrial membrane potential causes vascular remodeling in UCP2-deficient mice, partially via increased production of reactive oxygen species. PMID: 23590303
  51. A role is described for UCP2 in oxygen sensing and in pulmonary hypertension vascular remodeling. PMID: 23652801
  52. UCP2, functional due to fatty acids released by redox-activated mt-iPLA2gamma, suppresses mitochondrial superoxide production by its uncoupling action. PMID: 23354121
  53. Authors found that UCP2 knockout mice produced significantly more interferon-gamma (IFN-gamma), IL-17 and IL-13 than wild-type mice (P<0.05), suggesting that UCP2 knockout mice are resistant to Leishmania infection. PMID: 23437414
  54. Data from knockout mice suggest that lack of Ucp2 in islet alpha-cells perturbs glucagon response to fasting/caloric restriction hypoglycemia; thus, Ucp2 is necessary for normal alpha-cell glucose sensing and maintenance of euglycemia. PMID: 23434936
  55. The results show that UCP2 is rapidly mobilized during anaesthesia and sedation in immune cells, and suggest a role of UCP2 in locomotion. PMID: 22900002
  56. genipin inhibited UCP2 expression and ameliorated podocyte injury in DN mice. PMID: 22848482
  57. Both the UCP2 expression pattern and the time course of up-regulation in stimulated T-cells imply UCP2's involvement in the immune response, probably by controlling the metabolism during cell proliferation. PMID: 22870219
  58. Glutathionylation state of uncoupling protein-2 and the control of glucose-stimulated insulin secretion. PMID: 23035124
  59. Ucp2 has a critical role in the development of hippocampal neurons and circuits and hippocampus-related adult behaviors PMID: 22905184
  60. These results indicate a beneficial and secure dose of CLA for diet supplementation in mice, which induces UCP2 overexpression and UCP activity in mitochondria while preserving the lipid composition and redox state of the liver. PMID: 22864539
  61. H(2)S protects DA neurons against degeneration in a UCP2 rather than Kir6.2/K-ATP channel-dependent mechanism, which will give us an insight into the potential of H(2)S in terms of opening up new therapeutic avenues for PD. PMID: 22360462
  62. TRPV1 long-time activation might prevent high-fat diet-induced fatty liver in mice through upregulation of hepatic UCP2. PMID: 22395410
  63. UCP2 may serve as a negative regulator of GLP-1 secretion in the gastrointestinal trat. PMID: 22198816
  64. the neuroprotective effects of UCP2 against ischemic brain injury are associated with inhibition of pro-inflammatory cytokines and activation of cell survival factors. PMID: 22348126
  65. Mitochondrial superoxide production stimulated by adiponectin serves as a trigger to initiate the translocation of hnRNP K, which in turn promotes UCP2 expressions in liver. PMID: 22359684
  66. UCP2 preserves endothelial function through increasing nitric oxide bioavailability secondary to the inhibition of ROS production in the endothelium of obese diabetic mice. PMID: 22461387
  67. Results reveal an inhibitory role of uncoupling protein 2 in glucose-induced glucagon-like peptide 1 secretion. PMID: 22257551
  68. chronic PPARgamma stimulation leads to depolarization of the inner membrane and reduced superoxide of isolated heart mitochondria, which was critically dependent on increased expression of UCP-2 PMID: 22500511
  69. UCP2 sensitizes steatotic hepatocytes to hypoxia/reoxygenation through mitochondrial depolarization and ATP depletion but not lipid peroxidation. PMID: 22094601
  70. the compensatory down-regulation of UCP2 is involved in preserving the insulin secretory capacity of glucokinase mutant mice and might also be implicated in limiting disease progression in MODY2 patients. PMID: 22177951
  71. Data show that mice deficient for both Ucp2 and iNos genes developed milder disease with reduced immune cell infiltration, cytokines and ROS production as compared to iNos-/- mice. PMID: 21857957
  72. Study underlines the role of UCP2 in the age-related increase of oxidative stress and the oxidative stress-related RAGE/AGE interaction. PMID: 21820503
  73. our findings suggest that UCP2 knockout-induced inflammation may contribute to the development of depressive symptoms. PMID: 21729739
  74. UCP2 appears to be of minor relevance for the manifestation and extent of postischemic reperfusion injury in nondiseased livers with the increased ATP availability being counteracted by the higher pro-inflammatory IL-6 levels in UCP2 deficient mice. PMID: 20691984
  75. Data from beta-cell UCP2 KO mice (who exhibit glucose intolerance) suggest UCP2 in beta cell has role in regulation of intracellular ROS, contributes to glucose-stimulated secretion of insulin, and influences alpha-cell morphology/glucagon secretion. PMID: 21984579
  76. UCP2 is involved in anxiety-like behavior and modulates neuroendocrine and immune responses after stress. PMID: 21878341
  77. Induction of host UCP2 expression during Leishmania infection downregulates mitochondrial reactive oxygen species (ROS) generation, possibly preventing ROS-mediated protein tyrosine phosphatase inactivation to suppress macrophage defense mechanisms. PMID: 21705615
  78. Mutational and pharmacological studies indicated a direct role for Ucp2-mediated mitochondrial function in phagocytosis PMID: 21857682
  79. overexpression of UCP2 normalized angiogenic tube formation in aortic endothelial cells from either AMPKalpha1(-/-) or AMPKalpha2(-/-) mice PMID: 21597006
  80. a solution-NMR method for structural characterization of UCP2 PMID: 21785437
  81. UCP2 and UCP3 play roles in modulating metabolic efficiency, cell signaling, and oxidative stress processes PMID: 21515686
  82. Data show that null expression of Ucp2 induces transactivation of NF-kappaB in isolated islets, possibly due to NO-dependent up-regulation of inhibitor of kappaB kinase beta activity. PMID: 21321094
  83. study demonstrated that increased expression of miR-15a contributed to intracellular accumulation of insulin by repressing UCP-2 expression; suggests miR-15a is a mediator of beta cell function and insulin biosynthesis PMID: 21146880
  84. findings suggest that increased UCP2 and UCP3 levels may contribute to decreased myocardial mitochondrial bio-energetic function due to starvation PMID: 20932228
  85. Glucose excitation of melanin-concentrating hormone-expressing neurons in the lateral hypothalamus is mediated by K(ATP) channels and is negatively regulated by UCP2. PMID: 21035764
  86. Knocking out UCP2 gene exacerbates neuronal death after cerebral ischemia with reperfusion and this detrimental effect is mediated by alteration of antioxidant genes and upregulation of inflammatory mediators. UCP2 is innate regulator of inflammation. PMID: 20407461
  87. findings suggest that UCP2 plays an important role in preventing salt-sensitive hypertension, which may be achieved by suppressing superoxide production and reserving NO bioavailability in blood vessels. PMID: 20395942
  88. PPARgamma transactivation of both UCP2 and -3 is mediated through a novel enhancer in Ucp3 intron 1 PMID: 20360005
  89. Results show that UCP2 plays an important role in fat metabolism by promoting fat oxidation and restricts ghrelin-induced lipogenesis. PMID: 20189996
  90. Ghrelin's inhibitory effect on insulin secretion is partly mediated by the AMPK-UCP2 pathway. PMID: 20206170
  91. UCP2 serves as a brake in controlling polymorphonuclear leukocyte chemotaxis. The effect of UCP2 on polymorphonuclear leukocyte chemotaxis may be through modulating calcium influx. PMID: 20032292
  92. These data suggest that supplementation with isoleucine might be useful in the treatment of metabolic syndrome. PMID: 20089773
  93. UCP2 function in resting cells may be concerned with the control of ATP production rather than substrate oxidation. This study establishes that UCP2, expressed at endogenous levels, mediates proton leak in intact cells. PMID: 11756659
  94. no evidence could be gathered for the uncoupling activity of the UCP2 present in spleen or lung mitochondria PMID: 12011051
  95. LPS-stimulated signals suppress UCP2 expression by interrupting the function of intronic enhancer, leading to an up-regulation of intracellular reactive oxygen species, which activate the signal transduction cascade of NOS II expression. PMID: 12089332
  96. The protective role of UCP2 in brain injury by revealing its early induction after lesions and its inverse relationship with activation of an apoptotic signal, caspase 3, in wild-type and UCP2 overexpressing transgenic mice. PMID: 12147286
  97. Uncoupling protein 2 (UCP2) lowers alcohol sensitivity and pain threshold. PMID: 12147287
  98. UCP2 is expressed in the substantia gelatinosa and ventral horn of the rodent spinal cord. PMID: 12419545
  99. UCP-2 controls reactive oxygen species metabolism at the cellular level PMID: 12555808
  100. induction of electrogenic ion transport rather than electrophoretic fatty acid activity induced expression of hepatic uncoupling protein 2 (UCP-2) in wild type and PPARalpha-deficient mice PMID: 12756242

Show More

Hide All

Subcellular Location Mitochondrion inner membrane, Multi-pass membrane protein
Protein Families Mitochondrial carrier (TC 2.A.29) family
Tissue Specificity Highest in white adipose tissue, also detected in brown adipose tissue, heart and kidney. 4-6 times higher levels are detected in ob/ob and db/db mice.
Database Links

KEGG: mmu:22228

STRING: 10090.ENSMUSP00000120967

UniGene: Mm.171378

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1