Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Ybx1

Uniprot No.

P62960

Research Area

Others

Alternative Names

Ybx1; Msy-1; Msy1; Nsep1; Yb1; Y-box-binding protein 1; YB-1; CCAAT-binding transcription factor I subunit A; CBF-A; DNA-binding protein B; DBPB; Enhancer factor I subunit A; EFI-A; Nuclease-sensitive element-binding protein 1; Y-box transcription factor

Species

Mus musculus (Mouse)

Source

Yeast

Expression Region

2-322aa

Target Protein Sequence

SSEAETQQPPAAPAAALSAADTKPGSTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYARRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

37.6kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Introducing our Recombinant Mouse Ybx1, an accurately produced version of the Y-box-binding protein 1. This protein, also known as CCAAT-binding transcription factor I subunit A, DNA-binding protein B, Enhancer factor I subunit A, Nuclease-sensitive element-binding protein 1, and Y-box transcription factor, is native to the Mouse species. It's a crucial component in various cellular processes, making it an essential addition to your laboratory needs.

The Recombinant Mouse Ybx1 is a full-length mature protein spanning the complete expression region from 2-322 amino acids, ensuring its structural and functional fidelity to the native protein. It's produced in a yeast expression system and features an N-terminal 6xHis tag for seamless detection and purification. With a purity of over 90% as confirmed by SDS-PAGE, this product offers the quality and reliability required for your research. Depending on your specific experimental needs, the protein can be supplied in either liquid form or as a lyophilized powder.

Target Background

Function

DNA- and RNA-binding protein involved in various processes, such as translational repression, RNA stabilization, mRNA splicing, DNA repair and transcription regulation. Predominantly acts as a RNA-binding protein: binds preferentially to the 5'-[CU]CUGCG-3' RNA motif and specifically recognizes mRNA transcripts modified by C5-methylcytosine (m5C). Promotes mRNA stabilization: acts by binding to m5C-containing mRNAs and recruiting the mRNA stability maintainer ELAVL1, thereby preventing mRNA decay. Component of the CRD-mediated complex that promotes MYC mRNA stability. Contributes to the regulation of translation by modulating the interaction between the mRNA and eukaryotic initiation factors. Plays a key role in RNA composition of extracellular exosomes by defining the sorting of small non-coding RNAs, such as tRNAs, Y RNAs, Vault RNAs and miRNAs. Probably sorts RNAs in exosomes by recognizing and binding C5-methylcytosine (m5C)-containing RNAs. Acts as a key effector of epidermal progenitors by preventing epidermal progenitor senescence: acts by regulating the translation of a senescence-associated subset of cytokine mRNAs, possibly by binding to m5C-containing mRNAs. Also involved in pre-mRNA alternative splicing regulation: binds to splice sites in pre-mRNA and regulates splice site selection. Also able to bind DNA: regulates transcription of the multidrug resistance gene MDR1 is enhanced in presence of the APEX1 acetylated form at 'Lys-6' and 'Lys-7'. Binds to promoters that contain a Y-box (5'-CTGATTGGCCAA-3'), such as MDR1 and HLA class II genes. Promotes separation of DNA strands that contain mismatches or are modified by cisplatin. Has endonucleolytic activity and can introduce nicks or breaks into double-stranded DNA, suggesting a role in DNA repair. The secreted form acts as an extracellular mitogen and stimulates cell migration and proliferation.

Gene References into Functions

The study establishes YBX1 as a posttranscriptional effector required for maintenance of epidermal homeostasis. PMID: 29712925
his is the first report showing the increased expression of YB-1 during muscle regeneration after ischemic injury. PMID: 29353823
YB-1 orchestrates onset and resolution of renal inflammation via IL-10 gene regulation. PMID: 28664613
Monocytic YB-1 has prominent and distinct roles for cellular feed-forward crosstalk and resolution of inflammatory processes by its ability to regulate cell differentiation and cytokine/chemokine synthesis. PMID: 28610763
this study shows that innate immunity activation by muramyl peptides is mediated via an interaction between YB1 and NOD2 PMID: 27694635
In conclusion, TGF-beta signaling pathway may influence liver fibrosis by incorporating with YB-1, indicating that YB-1 could be a potential target for therapies against liver fibrosis. PMID: 28153731
Reduction in the expression of YBX1 and ILF3 controls the expression of pluripotency-related genes in ESCs, suggesting their roles in further regulation of the pluripotent state of ESCs. PMID: 26289635
YB-1 is a novel intracellular target of activated protein C in renal ischemia-reperfusion injury PMID: 26015455
miR-382 inhibits osteosarcoma metastasis and relapse by targeting YB-1 protein. PMID: 25292190
YB-1 was revealed in a population of Cajal bodies in 2-cell mouse embryos but not in other cells studied. PMID: 25175035
The effects of MIA/CD-RAP on transcriptional regulation in chondrocytes, through the regulation of p54(nrb) via YBX1 contributes to the understanding of chondrogenesis. PMID: 24349210
The formation of intracytoplasmic Gag-RNA complexes is facilitated by YB-1, which promotes MMTV virus assembly. PMID: 24501406
our findings identify YB-1 as a major, nonredundant mediator in both systemic and local inflammatory responses. PMID: 23872051
The amounts of YB-1 and YB-1 mRNA in rabbit organs and several cell lines. PMID: 23285076
Results indicate that both CD4(+) and CD8(+) T cells were involved in the anti-neuroblastoma responses induced by YB-1 immunization combined with Treg depletion. PMID: 23169344
findings show heterotopic cardiac transplant resulted in accumulation of 50-kDa YB-1 polypeptide within the polyribosome-enriched cytosol proximal to cardiac intercalated discs; YB-1 may govern cell response in the transplanted heart through its ability to bind and protect injury-activated mRNA transcripts that are prioritized for translation to assure graft adaptation PMID: 22619371
Extracellular inhibitory targeting of YB-1 potently induces glomerular Notch-3 receptor expression. PMID: 21372592
These results suggest that in skeletal muscle cells, neural activity reduces the molar ratio of YB-1 relative to its binding AChR alpha mRNA, leading to an increase of ribosome binding to the mRNA, and thus activating translation. PMID: 21964286
YBX1 is highly expressed in erythroid myeloid lymphoid-clone 1 (EML), a hematopoietic precursor cell line, but is down-regulated in myeloid progenitors and GM-CSF-treated EML cells during the course of myeloid differentiation. PMID: 21369783
A novel small compound that promotes nuclear translocation of YB-1 ameliorates experimental hepatic fibrosis in mice. PMID: 21115500
These results suggest that in the brain of growing mice, YB-1 binds to GluR2 and CaM1 mRNAs and regulates their translation in an activity-dependent manner. PMID: 20614234
YB-1 functions under the regulation of GATA factors in erythroid differentiation and aberrant expression of YB-1 gene may result in dyserythropoiesis PMID: 12646178
we biochemically identified a Sox21-associating protein, Y-box binding protein 1 which not only binds to Sox21 but also partially restores NGF-induced neurite outgrowth of PC12 cells inhibited by Sox21. PMID: 15039105
YB-1 may have the capacity to exert a protective role against cytotoxic effects of DNA damaging agents, and may be involved in certain aspects of drug resistance. PMID: 15072594
YB-1 normally represses the transcription of CDK inhibitors, making it an important component of the cellular stress response signaling pathway. PMID: 15899865
Association of YB-1 with the capped 5' terminus of the mRNA is regulated via phosphorylation by the serine/threonine protein kinase Akt. PMID: 16354698
the functional importance of the NSEP1 gene in murine early embryonic development PMID: 16598782
FBX33 as a component of an SCF E3-ubiquitin ligase that targets the multifunctional regulator Y-box binding protein 1 (YB-1)/dbpB/p50 for polyubiquitination and destruction by the proteasome. PMID: 16797541
The expression and polysome association of YB-1 in various tissues at different stages in the lifespan of mice PMID: 17045744
YB-1 is involved in early mouse development, including neural tube closure and cell proliferation. PMID: 17082189
conclude that HER-2 overexpressing as well as triple-negative breast cancer cells are YB-1 dependent, suggesting it may be a good therapeutic target for these exceptionally aggressive tumors PMID: 18974106
YB-1 transcription in the postnatal brain is regulated by a bHLH transcription factor Math2 through an E-box sequence in the 5'-UTR of the gene PMID: 19225866
Y-box binding protein-1 down-regulates expression of carbamoyl phosphate synthetase-I by suppressing CCAAT enhancer-binding protein-alpha function in mice. PMID: 19272383
Data demonstrate that extracellular YB-1 associates with outer cell membrane components and interacts with extracellular Notch-3 receptor domains. PMID: 19640841

Hide All

Subcellular Location

Cytoplasm. Nucleus. Cytoplasmic granule. Secreted. Secreted, extracellular exosome.

Tissue Specificity

Expressed at high levels in the testis. Present in the mRNP particles that mediate the storage and masking of mRNAs during spermiogenesis. In epidermis, expression is restricted to the cycling keratinocyte progenitors.

Database Links

KEGG: mmu:22608

STRING: 10090.ENSMUSP00000078589

UniGene: Mm.258204

Code	CSB-YP026247MO
Abbreviation	Recombinant Mouse Ybx1 protein
MSDS	MSDS Datasheet
Size	$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Nuclease-sensitive element-binding protein 1 (Ybx1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage