Recombinant Mouse Osteocalcin (Bglap)

In Stock
Code CSB-EP002682MO
Abbreviation Recombinant Mouse Bglap protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Bglap; Osteocalcin; Bone Gla protein; BGP; Gamma-carboxyglutamic acid-containing protein
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
50-95aa
Target Protein Sequence
YLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.1kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.
Gene References into Functions
  1. expression in offspring bone not changed by maternal high fat diet PMID: 25279792
  2. the uncarboxylated form of osteocalcin does not trigger Akt phosphorylation and glucose uptake by itself but promotes insulin-induced glucose uptake in myotubes, probably by up-regulating Akt signaling through ERK activation PMID: 25735975
  3. The Twist2-Cre, Osterix-Cre and osteocalcin-Cre lines to generate conditional beta1 integrin deletions, were used to investigate the role of beta1 integrins on skeletal phenotype. PMID: 25183373
  4. OCN is gamma-carboxylated by the gamma-carboxylase (GGCX) on three glutamic acid residues, a cellular process requiring reduction of vitamin K by a second enzyme, VKORC1. PMID: 25753038
  5. results showed an increase in the expression of Cbfa1 and OCN in fibroblasts and osteoblasts exposed to fluoride. PMID: 24680482
  6. Data indicate that Ca2+ binding triggered a similar conformational transition in both gamma-carboxyglutamic acid-containing protein osteocalcin (Gla-OCN) and Glu-OCN from a disordered structure to a more compact/stable form. PMID: 24896339
  7. In primary adipocytes, both carboxylated and uncarboxylated osteocalcin increased basal and insulin-stimulated glucose transport. PMID: 24554534
  8. Taken together, these findings demonstrate that SMILE negatively regulates osteocalcin via a direct interaction with RUNX2 PMID: 24389415
  9. Osteoblast-specific expression of Fra-2/AP-1 controls adiponectin and osteocalcin expression and affects metabolism. PMID: 24046454
  10. contribution of OC-OPN to fracture toughness is related to their presence at the extrafibrillar organic-mineral interfaces PMID: 24128197
  11. Insulin resistance in osteoblasts led to a decrease in circulating levels of the active form of osteocalcin, thereby decreasing insulin sensitivity in skeletal muscle. PMID: 24642469
  12. loss of osteocalcin/Gprc6a signaling has a profound effect on beta-cell mass accrual during late pancreas morphogenesis PMID: 24009262
  13. This study reveals that the skeleton via osteocalcin influences cognition and contributes to the maternal influence on fetal brain development. PMID: 24074871
  14. T3 stimulates the activation of Rho-kinase in osteoblasts, which functions as a negative regulator of T3-stimulated osteocalcin synthesis PMID: 23123502
  15. Uncarboxylated osteocalcin acts via Gprc6a to induce GLP-1 release from the gut; the stimulatory effect of uncarboxylated osteocalcin on insulin secretion is largely mediated by GLP-1. PMID: 23437377
  16. These results indicate that PP2A Calpha and its activity play a negative role in osteoblast differentiation and Osterix is a key factor responsible for regulating the expressions of Bsp and OCN during PP2A Calpha-mediated osteoblast differentiation. PMID: 23042641
  17. alphaNAC interacts with histone deacetylase corepressors to control Myogenin and Osteocalcin gene expression. PMID: 23092676
  18. Data from TR4 (steroid/thyroid hormone receptor 4) knockout mice suggest that TR4 binds to promoter region of osteocalcin gene and induces osteocalcin expression; this interaction maintains osteoblast activity during bone development/remodeling. PMID: 22676849
  19. Alterations of responses in knockout mice that suggest participation of osteocalcin in transmission of information about those sensory stimuli. PMID: 22350212
  20. BMP2 induces osteoblast differentiation through Runx2-dependent ATF6 expression, which directly regulates Oc transcription. PMID: 22102412
  21. Data show that Mkp1 KO mice displayed delayed differentiation and reduced expressions of osteocalcin (OCN) and Runx2 genes associated with osteoblast maturation and function. PMID: 21852324
  22. Both BGP overexpression and treatment with purified Bone Gla Protein (BGP) resulted in stabilization of hypoxia-inducible factor 1alpha (HIF-1alpha) in chondrocytes and vascular smooth muscle cells PMID: 21757657
  23. Foxo1 is a novel negative regulator of osteoblast-specific transcription factor Runx2 and modulates IGF1/insulin-dependent regulation of osteocalcin expression in osteoblasts. PMID: 21471200
  24. Data show that osteocalcin synthesis was significantly reduced in the stable HSP27-transfected MC3T3-E1 cells and normal human osteoblasts. PMID: 21427224
  25. Findings expand the biological importance of osteocalcin, begin to unravel its molecular mode of action, and provide the first evidence that the skeleton is an endocrine regulator of fertility. PMID: 21333348
  26. the activation of PPARgamma inhibits osteocalcin expression both by suppressing the expression of Runx2 and by interfering with the transactivation ability of Runx2 PMID: 12704187
  27. 1,25-(OH)(2)D(3)and T3 upregulated osteocalcin, depending on the stage of cell differentiation. PMID: 12798773
  28. osteocalcin fibroblast growth factor response element activation is enhanced by MINT, the Msx2 interacting nuclear matrix target PMID: 15131132
  29. Nell-1 reduced osterix-producing cells and increased bone sialoprotein, osteocalcin, and BMP-7 expression. PMID: 16936265
  30. Expression of the osteoblast-specific gene OC was examined in marrow stromal cell cultures at various time points. PMID: 17705049
  31. during osteoblast differentiation, early on, when Runx2 protein and DNA-binding are maximal, Runx2 is nearly absent from the OC promoter. Later, Runx2 is recruited to the OC promoter as Runx2 mRNA, protein, and in vitro DNA binding progressively decrease. PMID: 18821584
  32. Results show that induction of alkaline phosphatase, type I collagen, osteocalcin, CD44, CD47 and CD51 by mevinolin is responsible for the osteoblastic differentiation of D1 cells. PMID: 19162043

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Osteocalcin/matrix Gla protein family
Tissue Specificity
Bone.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*