Home
Protein
Recombinant Protein
Recombinant Mycobacterium tuberculosis Hypoxic response protein 1 (hrp1)

Recombinant Mycobacterium tuberculosis Hypoxic response protein 1 (hrp1)

^{In Stock}

Code	CSB-EP516950MVZ
MSDS	MSDS
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP516950MVZ could indicate that this peptide derived from E.coli-expressed Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) hrp1. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP516950MVZ could indicate that this peptide derived from E.coli-expressed Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) hrp1.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

hrp1

Uniprot No.

P9WJA3

Research Area

others

Alternative Names

hrp1; Rv2626cHypoxic response protein 1; HRP1

Species

Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

Source

E.coli

Expression Region

1-143aa

Target Protein Sequence

MTTARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLAAGLDPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGIVTEADIARHLPEHAIVQFVKAICSPMALAS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

35.5kDa

Protein Length

Full Length

Tag Info

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

We have several post-sale questions (CSB-EP516950MVZ):
1. We will not use the whole protein in one shot, and would rather aliquot it. Our question is: which is the best buffer to create a stock solution?
2. What would be the best concentration for this stock solution?
3. Which temperature should it be kept?

Very nice to receive your inquiry.
1. As shown in our Datasheet&COA, the storage buffer of this protein is 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, pH 8.0, 50% glycerol.
You can directly pack it into small specifications according to your needs.
2. The protein concentration of this lot is 0.3mg/ml. We suggest you to make aliquotes directly, and don't suggest to add buffer to dilute the protein before making aliquotes.
The lower the protein concentration, the more unstable.
3. Regarding the storage temperature, if you do not intend to use the protein in a short period, we recommend storing it at -20 ° C to -80 ° C (Be sure to avoid repeated freezing and thawing).

We have two questions:
1. Can aliquots be stored in Matrix tubes, or would you suggest tubes with low binding property for proteins?
2. Can they use HBSS or PBS (ph 7.4) to create an intermediate working solution, prior final dilution in blood or PBMCs?

Thanks for your inquiry.
1. We use Axygen's (an US company) cryotube (99.9% bio-grade polypropylene as raw material, without any metal ions) for storage and transportation.
The customer could make choice according to the tube we used.
2. In theory, the customer can use HBSS or PBS (ph 7.4) to create an intermediate working solution, prior final dilution in blood or PBMCs.
However, we have not done relevant experiment yet, and the customer can have a try firstly.
Please do not to contact us if the customer has further questions. Have a nice day.

Target Background

Function

Unlike some other CBS-domain containing proteins does not seem to bind AMP.

Gene References into Functions

Mycobacterium tuberculosis protein Rv2626c plays a significant role in stimulating macrophages to provoke a pro-inflammatory response and in mycobacterial survival during infection. PMID: 28671529
Rv2626c \appears to modulate macrophage effector functions by eliciting both innate and adaptive immune responses PMID: 20201990

Subcellular Location

Secreted. Note=Not seen to be associated with the cell wall.

Database Links

KEGG: mtu:Rv2626c

STRING: 83332.Rv2626c

Promotions