Recombinant Rat Glutathione S-transferase P(Gstp1)

In Stock
Code CSB-EP009989RA
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P04906
Lead Time 3-7 business days
Relevance Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration .
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Chain 7GST 7-7GST class-pi
Species Rattus norvegicus (Rat)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence PPYTIVYFPVRGRCEATRMLLADQGQSWKEEVVTIDVWLQGSLKSTCLYGQLPKFEDGDLTLYQSNAILRHLGRSLGLYGKDQKEAALVDMVNDGVEDLRCKYGTLIYTNYENGKDDYVKALPGHLKPFETLLSQNQGGKAFIVGNQISFADYNLLDLLLVHQVLAPGCLDNFPLLSAYVARLSARPKIKAFLSSPDHLNRPINGNGKQ
Research Area Others
Source E.coli
Gene Names Gstp1
Expression Region 2-210aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 27.3kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration (By similarity).
Subcellular Location Cytoplasm, Mitochondrion, Nucleus
Protein Families GST superfamily, Pi family
Tissue Specificity Present in kidney, lung, testis and placenta, very low levels in liver.
Database Links

KEGG: rno:24426

STRING: 10116.ENSRNOP00000024601

UniGene: Rn.87063

Related Products

Gstp1 Antibodies

Gstp1 Antibodies for Rattus norvegicus (Rat)

Gstp1 Antibodies for Rat

Gstp1 Proteins

Gstp1 Proteins for Rattus norvegicus (Rat)

Gstp1 ELISA Kit

Gstp1 ELISA Kit for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.