Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Gstp1

Uniprot No.

P04906

Research Area

Others

Alternative Names

Gstp1; Glutathione S-transferase P; EC 2.5.1.18; Chain 7; GST 7-7; GST class-pi

Species

Rattus norvegicus (Rat)

Source

E.coli

Expression Region

2-210aa

Target Protein Sequence

PPYTIVYFPVRGRCEATRMLLADQGQSWKEEVVTIDVWLQGSLKSTCLYGQLPKFEDGDLTLYQSNAILRHLGRSLGLYGKDQKEAALVDMVNDGVEDLRCKYGTLIYTNYENGKDDYVKALPGHLKPFETLLSQNQGGKAFIVGNQISFADYNLLDLLLVHQVLAPGCLDNFPLLSAYVARLSARPKIKAFLSSPDHLNRPINGNGKQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

27.3kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

We are proud to introduce the Recombinant Rat Glutathione S-transferase P, a vital element in your molecular research. This protein, also known as Chain 7, GST 7-7, or GST class-pi, is encoded by the 'Gstp1' gene in the Rat species. Its multifunctional properties make it essential to an array of physiological processes, including protection against oxidative stress.

Produced in E.coli, our product includes the full length of the mature protein, extending from amino acid 2 to 210. The inclusion of an N-terminal 6xHis tag aids in its easy detection and purification. We ensure that this product is of high quality, having a purity level greater than 90%, as determined by SDS-PAGE. You can select either a liquid form or a lyophilized powder, according to your research needs. With our Recombinant Rat Gstp1, you can confidently proceed with your experiments, knowing you're equipped with reliable reagents.

Target Background

Function

Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Involved in the formation of glutathione conjugates of both prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2). Participates in the formation of novel hepoxilin regioisomers. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration.

Gene References into Functions

The cytotoxic action of 2-acetylaminofluorene that give rise to the GST-P(+) single hepatocytes was suggested to be an injury to the excretory pump(s) and the duct of hepatocytes. A new physiological mechanism was hypothesized for the induction of preneoplastic cell populations in the rat liver instead of a genetic mechanism. PMID: 29501922
Data suggest that expression of Gstp1 can be regulated by dietary factors; here, Gstp1 is induced in hepatocytes by carnosic acid, an anticarcinogenic component of rosemary (Rosmarinus officinalis). PMID: 25974399
Data show that Valerian extract inhibits hepatocarcinogenesis by suppressing cell proliferation and inducing apoptosis in glutathione S-transferase pi GST-P(+) foci by activating gamma-aminobutyric acid A receptor GABA(A)RA1-mediated signaling. PMID: 25419570
Cisplatin metabolism in different organs of rats correlated positively with specific GSTP1 activities and this enzyme may be a critical determinant of extent of cellular uptake or retention of cisplatin in renal and liver tissues. PMID: 24474500
GSTP1 application early after myocardial infarction results in long-term beneficial structural and functional effects that prevent progression to heart faiilure. PMID: 24412522
GST-P(-) foci induced by promotion with agonists of peroxisome proliferator-activated receptor-alpha. PMID: 20423715
GSTpi directly associated with signal transducer and activator of transcription 3 (STAT3) to prevent Angiotensin II-triggered binding of Src to STAT3. PMID: 24321768
The change in expression of GST-pi in peripheral blood showed the same pattern as that in brain tissues, suggesting GST-pi might contribute to drug resistance in epilepsy. PMID: 22038365
GST-P-positive lesions may involve a mechanism facilitating lipid peroxidation PMID: 20091025
Exposure to diesel exhaust particles elevated transcription of glutathione-s-transferase gene in rat alveolar macrophages. PMID: 12011483
GSTpi proteins play an important role in the development of acquired drug resistance to various drugs of prostate cancer cells. PMID: 15809768
glutathione S-transferase P1 is induced by proteasome inhibitors PMID: 15863507
Hepaticcgene expression is upregulated by a limited availability of sulfur amino acids PMID: 15867277
GST-Pi expression was induced by the metabolites of cyclophoshamide. PMID: 16242832
Expression of GST-P gene is down-regulated by CCAAT enhancer-binding protein alpha in normal liver. PMID: 16407263
Drug resistant prostate cancer cells displayed significantly increased expression of GSTP1 with other prostate cancer cells. PMID: 16728343
The upregulation of MIF and GSTpi during the development of acquired drug resistance of hormone independent prostate cancer may modulate the activation of gp-170 PMID: 16728344
Expression of GST-P is correlated with cellular proliferation and is associated with risk and progression of oral cancer. PMID: 17596925
These data indicate that expression of GST-P may reflect the carcinogenic effect of cigarette smoke as well as the genetic susceptibility of animals in relation to continuous carcinogens exposure. PMID: 17786572
development of GST-P-negative foci during the early stage of hepatocarcinogenesis PMID: 18081878

Hide All

Subcellular Location

Cytoplasm. Mitochondrion. Nucleus.

Protein Families

GST superfamily, Pi family

Tissue Specificity

Present in kidney, lung, testis and placenta, very low levels in liver.

Database Links

KEGG: rno:24426

STRING: 10116.ENSRNOP00000024601

UniGene: Rn.87063

Code	CSB-EP009989RA
Abbreviation	Recombinant Rat Gstp1 protein
MSDS	MSDS Datasheet
Size	US$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Rat Glutathione S-transferase P (Gstp1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage