Recombinant Rat Glutathione S-transferase P (Gstp1)

In Stock
Code CSB-EP009989RA
Abbreviation Recombinant Rat Gstp1 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Gstp1; Glutathione S-transferase P; EC 2.5.1.18; Chain 7; GST 7-7; GST class-pi
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
2-210aa
Target Protein Sequence
PPYTIVYFPVRGRCEATRMLLADQGQSWKEEVVTIDVWLQGSLKSTCLYGQLPKFEDGDLTLYQSNAILRHLGRSLGLYGKDQKEAALVDMVNDGVEDLRCKYGTLIYTNYENGKDDYVKALPGHLKPFETLLSQNQGGKAFIVGNQISFADYNLLDLLLVHQVLAPGCLDNFPLLSAYVARLSARPKIKAFLSSPDHLNRPINGNGKQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.3kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

We are proud to introduce the Recombinant Rat Glutathione S-transferase P, a vital element in your molecular research. This protein, also known as Chain 7, GST 7-7, or GST class-pi, is encoded by the 'Gstp1' gene in the Rat species. Its multifunctional properties make it essential to an array of physiological processes, including protection against oxidative stress.

Produced in E.coli, our product includes the full length of the mature protein, extending from amino acid 2 to 210. The inclusion of an N-terminal 6xHis tag aids in its easy detection and purification. We ensure that this product is of high quality, having a purity level greater than 90%, as determined by SDS-PAGE. You can select either a liquid form or a lyophilized powder, according to your research needs. With our Recombinant Rat Gstp1, you can confidently proceed with your experiments, knowing you're equipped with reliable reagents.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Involved in the formation of glutathione conjugates of both prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2). Participates in the formation of novel hepoxilin regioisomers. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration.
Gene References into Functions
  1. The cytotoxic action of 2-acetylaminofluorene that give rise to the GST-P(+) single hepatocytes was suggested to be an injury to the excretory pump(s) and the duct of hepatocytes. A new physiological mechanism was hypothesized for the induction of preneoplastic cell populations in the rat liver instead of a genetic mechanism. PMID: 29501922
  2. Data suggest that expression of Gstp1 can be regulated by dietary factors; here, Gstp1 is induced in hepatocytes by carnosic acid, an anticarcinogenic component of rosemary (Rosmarinus officinalis). PMID: 25974399
  3. Data show that Valerian extract inhibits hepatocarcinogenesis by suppressing cell proliferation and inducing apoptosis in glutathione S-transferase pi GST-P(+) foci by activating gamma-aminobutyric acid A receptor GABA(A)RA1-mediated signaling. PMID: 25419570
  4. Cisplatin metabolism in different organs of rats correlated positively with specific GSTP1 activities and this enzyme may be a critical determinant of extent of cellular uptake or retention of cisplatin in renal and liver tissues. PMID: 24474500
  5. GSTP1 application early after myocardial infarction results in long-term beneficial structural and functional effects that prevent progression to heart faiilure. PMID: 24412522
  6. GST-P(-) foci induced by promotion with agonists of peroxisome proliferator-activated receptor-alpha. PMID: 20423715
  7. GSTpi directly associated with signal transducer and activator of transcription 3 (STAT3) to prevent Angiotensin II-triggered binding of Src to STAT3. PMID: 24321768
  8. The change in expression of GST-pi in peripheral blood showed the same pattern as that in brain tissues, suggesting GST-pi might contribute to drug resistance in epilepsy. PMID: 22038365
  9. GST-P-positive lesions may involve a mechanism facilitating lipid peroxidation PMID: 20091025
  10. Exposure to diesel exhaust particles elevated transcription of glutathione-s-transferase gene in rat alveolar macrophages. PMID: 12011483
  11. GSTpi proteins play an important role in the development of acquired drug resistance to various drugs of prostate cancer cells. PMID: 15809768
  12. glutathione S-transferase P1 is induced by proteasome inhibitors PMID: 15863507
  13. Hepaticcgene expression is upregulated by a limited availability of sulfur amino acids PMID: 15867277
  14. GST-Pi expression was induced by the metabolites of cyclophoshamide. PMID: 16242832
  15. Expression of GST-P gene is down-regulated by CCAAT enhancer-binding protein alpha in normal liver. PMID: 16407263
  16. Drug resistant prostate cancer cells displayed significantly increased expression of GSTP1 with other prostate cancer cells. PMID: 16728343
  17. The upregulation of MIF and GSTpi during the development of acquired drug resistance of hormone independent prostate cancer may modulate the activation of gp-170 PMID: 16728344
  18. Expression of GST-P is correlated with cellular proliferation and is associated with risk and progression of oral cancer. PMID: 17596925
  19. These data indicate that expression of GST-P may reflect the carcinogenic effect of cigarette smoke as well as the genetic susceptibility of animals in relation to continuous carcinogens exposure. PMID: 17786572
  20. development of GST-P-negative foci during the early stage of hepatocarcinogenesis PMID: 18081878

Show More

Hide All

Subcellular Location
Cytoplasm. Mitochondrion. Nucleus.
Protein Families
GST superfamily, Pi family
Tissue Specificity
Present in kidney, lung, testis and placenta, very low levels in liver.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*