Recombinant Rat Striatin(Strn)

Product Type Recombinant Protein
Uniprot No. P70483
Species Rattus norvegicus (Rat)
Gene Names Strn
Protein Names Recommended name: Striatin
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
HGNC 11424
RGD 3782
MGI 1333757
Function Binds calmodulin in a calcium dependent manner. May function as scaffolding or signaling protein.
Subcellular Location Cytoplasm, Membrane, Peripheral membrane protein, Cell projection, dendritic spine
Protein Families WD repeat striatin family
Tissue Specificity Mainly expressed in the central nervous system. Mostly confined in dendrites, not in axons, and is most abundant in dendritic spines.
Database Links

KEGG: rno:29149

STRING: 10116.ENSRNOP00000006527

UniGene: Rn.15451

Product Details for Different Expression Systems

Product Name Recombinant Rat Striatin(Strn),Yeast
Code CSB-YP022880RA
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MDEQAGPGVFFSNNHPGAGGAKGLGPLAEAAAAGDGAAAAGAARAQYSLPGILHFLQHEW ARFEVERAQWEVERAELQAQIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAKYHKLK YGTELNQGDMKPPSYDSDEGNETEVQPQQNSQFMWKQGRQLLRQYLQEVGYTDTILDVKS KRVRALLGFSSDVTDREDDKNQDSVINGTEAEVKETAMIGKSELTDSASVLDNFKFLENA AADFSDEDEDEDIDGREKSVIDTSTIVRKKPLPDTSEDRDTKEALKEFDFLVASEEGDNE SRSAGDGTDWEKEDQCLTPERWNVDQGVITRLKEQYKKERKGKKGVKRPNRSKLQDMLAN LRDVDELPSLQPSVGSPSRPSSSRLPEQDISRADEVEALTFPPSSGKSFIMGADEALESE LGLGELAGLTVANEADSLAYDIANNKDALRKTWNPKFTLRSHFDGIRALAFHPIEPVLIT ASEDHTLKMWNLQKTAPAKKSTSLDVEPIYTFRAHKGPVLCVVMSSNGEQCYSGGTDGLI QSWSTTNPNVDPYDSYDPSVLRGPLLGHTDAVWGLAYSAAHQRLLSCSADGTLRLWTTTE VAPALTVFNDNQELGIPASVDLVSSDPSHMVASFSKGYTSIFNMETQQRILTLESNVDST ASSSCQINRVISHPTLPISITAHEDRHIKFYDNNTGKLIHSMVAHLEAVTSLAVDPNGLY LMSGSHDCSIRLWNLESKTCIQEFTAHRKKFEESIHDVAFHPSKCYIASAGADALAKVFV
Expression Region 1-780
Protein Description Full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Rat Striatin(Strn),E.coli
Code CSB-EP022880RA
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MDEQAGPGVFFSNNHPGAGGAKGLGPLAEAAAAGDGAAAAGAARAQYSLPGILHFLQHEW ARFEVERAQWEVERAELQAQIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAKYHKLK YGTELNQGDMKPPSYDSDEGNETEVQPQQNSQFMWKQGRQLLRQYLQEVGYTDTILDVKS KRVRALLGFSSDVTDREDDKNQDSVINGTEAEVKETAMIGKSELTDSASVLDNFKFLENA AADFSDEDEDEDIDGREKSVIDTSTIVRKKPLPDTSEDRDTKEALKEFDFLVASEEGDNE SRSAGDGTDWEKEDQCLTPERWNVDQGVITRLKEQYKKERKGKKGVKRPNRSKLQDMLAN LRDVDELPSLQPSVGSPSRPSSSRLPEQDISRADEVEALTFPPSSGKSFIMGADEALESE LGLGELAGLTVANEADSLAYDIANNKDALRKTWNPKFTLRSHFDGIRALAFHPIEPVLIT ASEDHTLKMWNLQKTAPAKKSTSLDVEPIYTFRAHKGPVLCVVMSSNGEQCYSGGTDGLI QSWSTTNPNVDPYDSYDPSVLRGPLLGHTDAVWGLAYSAAHQRLLSCSADGTLRLWTTTE VAPALTVFNDNQELGIPASVDLVSSDPSHMVASFSKGYTSIFNMETQQRILTLESNVDST ASSSCQINRVISHPTLPISITAHEDRHIKFYDNNTGKLIHSMVAHLEAVTSLAVDPNGLY LMSGSHDCSIRLWNLESKTCIQEFTAHRKKFEESIHDVAFHPSKCYIASAGADALAKVFV
Expression Region 1-780
Protein Description Full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Rat Striatin(Strn),Baculovirus
Code CSB-BP022880RA
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MDEQAGPGVFFSNNHPGAGGAKGLGPLAEAAAAGDGAAAAGAARAQYSLPGILHFLQHEW ARFEVERAQWEVERAELQAQIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAKYHKLK YGTELNQGDMKPPSYDSDEGNETEVQPQQNSQFMWKQGRQLLRQYLQEVGYTDTILDVKS KRVRALLGFSSDVTDREDDKNQDSVINGTEAEVKETAMIGKSELTDSASVLDNFKFLENA AADFSDEDEDEDIDGREKSVIDTSTIVRKKPLPDTSEDRDTKEALKEFDFLVASEEGDNE SRSAGDGTDWEKEDQCLTPERWNVDQGVITRLKEQYKKERKGKKGVKRPNRSKLQDMLAN LRDVDELPSLQPSVGSPSRPSSSRLPEQDISRADEVEALTFPPSSGKSFIMGADEALESE LGLGELAGLTVANEADSLAYDIANNKDALRKTWNPKFTLRSHFDGIRALAFHPIEPVLIT ASEDHTLKMWNLQKTAPAKKSTSLDVEPIYTFRAHKGPVLCVVMSSNGEQCYSGGTDGLI QSWSTTNPNVDPYDSYDPSVLRGPLLGHTDAVWGLAYSAAHQRLLSCSADGTLRLWTTTE VAPALTVFNDNQELGIPASVDLVSSDPSHMVASFSKGYTSIFNMETQQRILTLESNVDST ASSSCQINRVISHPTLPISITAHEDRHIKFYDNNTGKLIHSMVAHLEAVTSLAVDPNGLY LMSGSHDCSIRLWNLESKTCIQEFTAHRKKFEESIHDVAFHPSKCYIASAGADALAKVFV
Expression Region 1-780
Protein Description Full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Rat Striatin(Strn),Mammalian cell
Code CSB-MP022880RA
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MDEQAGPGVFFSNNHPGAGGAKGLGPLAEAAAAGDGAAAAGAARAQYSLPGILHFLQHEW ARFEVERAQWEVERAELQAQIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAKYHKLK YGTELNQGDMKPPSYDSDEGNETEVQPQQNSQFMWKQGRQLLRQYLQEVGYTDTILDVKS KRVRALLGFSSDVTDREDDKNQDSVINGTEAEVKETAMIGKSELTDSASVLDNFKFLENA AADFSDEDEDEDIDGREKSVIDTSTIVRKKPLPDTSEDRDTKEALKEFDFLVASEEGDNE SRSAGDGTDWEKEDQCLTPERWNVDQGVITRLKEQYKKERKGKKGVKRPNRSKLQDMLAN LRDVDELPSLQPSVGSPSRPSSSRLPEQDISRADEVEALTFPPSSGKSFIMGADEALESE LGLGELAGLTVANEADSLAYDIANNKDALRKTWNPKFTLRSHFDGIRALAFHPIEPVLIT ASEDHTLKMWNLQKTAPAKKSTSLDVEPIYTFRAHKGPVLCVVMSSNGEQCYSGGTDGLI QSWSTTNPNVDPYDSYDPSVLRGPLLGHTDAVWGLAYSAAHQRLLSCSADGTLRLWTTTE VAPALTVFNDNQELGIPASVDLVSSDPSHMVASFSKGYTSIFNMETQQRILTLESNVDST ASSSCQINRVISHPTLPISITAHEDRHIKFYDNNTGKLIHSMVAHLEAVTSLAVDPNGLY LMSGSHDCSIRLWNLESKTCIQEFTAHRKKFEESIHDVAFHPSKCYIASAGADALAKVFV
Expression Region 1-780
Protein Description Full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.