Recombinant Salmonella paratyphi B tRNA sulfurtransferase(thiI)

Product Type Recombinant Protein
Uniprot No. A9MX06
Species Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Gene Names thiI
Protein Names Recommended name: tRNA sulfurtransferase EC= 2.8.1.4 Alternative name(s): Sulfur carrier protein ThiS sulfurtransferase Thiamine biosynthesis protein ThiI tRNA 4-thiouridine synthase
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function Catalyzes the ATP-dependent transfer of a sulfur to tRNA to produce 4-thiouridine in position 8 of tRNAs, which functions as a near-UV photosensor. Also catalyzes the transfer of sulfur to the sulfur carrier protein ThiS, forming ThiS-thiocarboxylate. This is a step in the synthesis of thiazole, in the thiamine biosynthesis pathway. The sulfur is donated as persulfide by IscS.
Subcellular Location Cytoplasm
Protein Families ThiI family
Database Links

KEGG: spq:SPAB_03158

Product Details for Different Expression Systems

Product Name Recombinant Salmonella paratyphi B tRNA sulfurtransferase(thiI),Yeast
Code CSB-YP433084STF
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MKFIIKLFPEITIKSQSVRLRFIKILTGNIRNVLKHYDETLAVVRHWDNIEVRAKDENQR LAIRDALTRIPGIHHILEVEDVPFTDMHDIFEKALAQYREQLEGKTFCVRVKRRGKHEFS SIEVERYVGGGLNQHIESARVKLTNPDVTVHLEVEDDRLLLIKGRYEGIGGFPIGTQEDV LSLISGGFDSGVSSYMLMRRGCRVHYCFFNLGGAAHEIGVRQVAHYLWNRFGSSHRVRFV AINFEPVVGEILEKVDDGQMGVVLKRMMVRAASKVAERYGVQALVTGEALGQVSSQTLTN LRLIDNVSDTLILRPLISYDKEHIINLARQIGTEDFARTMPEYCGVISKSPTVKAIKAKI EAEEENFDFSILDKVVEEANNVDMREIAQQTQQEVVEVETVSGFGANDVILDIRSVDEQD DKPLKVEGVDVVSLPFYKLSTKFGDLDQSKTWLLWCERGVMSRLQALYLREQGFANVKVY RP
Expression Region 1-482
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Salmonella paratyphi B tRNA sulfurtransferase(thiI),E.coli
Code CSB-EP433084STF
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MKFIIKLFPEITIKSQSVRLRFIKILTGNIRNVLKHYDETLAVVRHWDNIEVRAKDENQR LAIRDALTRIPGIHHILEVEDVPFTDMHDIFEKALAQYREQLEGKTFCVRVKRRGKHEFS SIEVERYVGGGLNQHIESARVKLTNPDVTVHLEVEDDRLLLIKGRYEGIGGFPIGTQEDV LSLISGGFDSGVSSYMLMRRGCRVHYCFFNLGGAAHEIGVRQVAHYLWNRFGSSHRVRFV AINFEPVVGEILEKVDDGQMGVVLKRMMVRAASKVAERYGVQALVTGEALGQVSSQTLTN LRLIDNVSDTLILRPLISYDKEHIINLARQIGTEDFARTMPEYCGVISKSPTVKAIKAKI EAEEENFDFSILDKVVEEANNVDMREIAQQTQQEVVEVETVSGFGANDVILDIRSVDEQD DKPLKVEGVDVVSLPFYKLSTKFGDLDQSKTWLLWCERGVMSRLQALYLREQGFANVKVY RP
Expression Region 1-482
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Salmonella paratyphi B tRNA sulfurtransferase(thiI),Baculovirus
Code CSB-BP433084STF
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MKFIIKLFPEITIKSQSVRLRFIKILTGNIRNVLKHYDETLAVVRHWDNIEVRAKDENQR LAIRDALTRIPGIHHILEVEDVPFTDMHDIFEKALAQYREQLEGKTFCVRVKRRGKHEFS SIEVERYVGGGLNQHIESARVKLTNPDVTVHLEVEDDRLLLIKGRYEGIGGFPIGTQEDV LSLISGGFDSGVSSYMLMRRGCRVHYCFFNLGGAAHEIGVRQVAHYLWNRFGSSHRVRFV AINFEPVVGEILEKVDDGQMGVVLKRMMVRAASKVAERYGVQALVTGEALGQVSSQTLTN LRLIDNVSDTLILRPLISYDKEHIINLARQIGTEDFARTMPEYCGVISKSPTVKAIKAKI EAEEENFDFSILDKVVEEANNVDMREIAQQTQQEVVEVETVSGFGANDVILDIRSVDEQD DKPLKVEGVDVVSLPFYKLSTKFGDLDQSKTWLLWCERGVMSRLQALYLREQGFANVKVY RP
Expression Region 1-482
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Salmonella paratyphi B tRNA sulfurtransferase(thiI),Mammalian cell
Code CSB-MP433084STF
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MKFIIKLFPEITIKSQSVRLRFIKILTGNIRNVLKHYDETLAVVRHWDNIEVRAKDENQR LAIRDALTRIPGIHHILEVEDVPFTDMHDIFEKALAQYREQLEGKTFCVRVKRRGKHEFS SIEVERYVGGGLNQHIESARVKLTNPDVTVHLEVEDDRLLLIKGRYEGIGGFPIGTQEDV LSLISGGFDSGVSSYMLMRRGCRVHYCFFNLGGAAHEIGVRQVAHYLWNRFGSSHRVRFV AINFEPVVGEILEKVDDGQMGVVLKRMMVRAASKVAERYGVQALVTGEALGQVSSQTLTN LRLIDNVSDTLILRPLISYDKEHIINLARQIGTEDFARTMPEYCGVISKSPTVKAIKAKI EAEEENFDFSILDKVVEEANNVDMREIAQQTQQEVVEVETVSGFGANDVILDIRSVDEQD DKPLKVEGVDVVSLPFYKLSTKFGDLDQSKTWLLWCERGVMSRLQALYLREQGFANVKVY RP
Expression Region 1-482
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.