Recombinant Bacillus subtilis Cytochrome c oxidase subunit 2(ctaC)

Code CSB-CF015073BRJ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P24011
Storage Buffer Tris-based buffer,50% glycerol
Species Bacillus subtilis (strain 168)
Sequence CGKPFLSTLKPAGEVADKQYDLTVLSTLIMVVVVAVVSVIFFYVIVRFRRSRVGENTIPK QVEGNKFLEITWTVIPILLLIILVIPVVLYTLELADTSPMDKKGRKAEDALVVNVRANLY WWEFEYPDYGIITSQELIVPTDQRVYFNLKASDVKHSFWIPSVGGKLDTNTDNENKFFLT FDSKRSKEAGDMFFGKCAELCGPSHALMDFKVKTMSAKEFQGWTKEMKNYKSTAESDLAK QGEELFKEKNCLSCHAVEPNDKRAEAARTAPNLATFGERTKVAGVKEANKENVKAWLKDP DSIKPGNKMTGTYPKLSDSETNALYEYLKGLKAESK
Source in vitro E.coli expression system
Gene Names ctaC
Protein Names Recommended name: Cytochrome c oxidase subunit 2 EC= 1.9.3.1 Alternative name(s): Caa-3605 subunit 2 Cytochrome aa3 subunit 2 Cytochrome c oxidase polypeptide II Oxidase aa(3) subunit 2
Expression Region 21-356
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Subunits I and II form the functional core of the enzyme complex. Electrons originating in cytochrome c are transferred via heme a and Cu(A) to the binuclear center formed by heme a3 and Cu(B).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Cytochrome c oxidase subunit 2 family
Database Links

KEGG: bsu:BSU14890

STRING: 224308.Bsubs1_010100008241

Related Products

ctaC Proteins

ctaC Proteins for Bacillus subtilis (strain 168)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.