Recombinant Brucella abortus biovar 1 Type IV secretion system protein virB6(virB6)

Code CSB-CF314347BWS
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P0C527
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Brucella abortus biovar 1 (strain 9-941)
Sequence MVNPVIFEFIGTSIHNQLNNYVTMVASNTMNMIATTAVLAGGLYYTAMGILMSVGRIEGP FSQLVISCIKFMLIAAFALNISTYSEWVIDTVHNMESGFADAFAGNHGTPSSTIYQTLDN SLGKGWNIAAMLFEKGDNRGLTQIVQGFSELLLSFLVAGSTLILAGPTGAMIVATNAVIA ILLGIGPLFILALGWAPTRGFFDRWFGAIVTSILQVALLSAVLSISSAIFSRMVAAINLA SATQSTLFSCLSLTAVTIVMPYMMYKVYEYGGILGSSISAATISLGSLAVNTATSGGGAM TSIFSGSSGGGGSGSAKAGGESSYSAGGNAMWSPAYRQHVLGQFNRD
Source in vitro E.coli expression system
Gene Names virB6
Protein Names Recommended name: Type IV secretion system protein virB6
Expression Region 1-347
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families TrbL/VirB6 family
Database Links

KEGG: bmb:BruAb2_0064

Related Products

virB6 Proteins

virB6 Proteins for Brucella abortus biovar 1 (strain 9-941)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.