Recombinant Chicken E3 ubiquitin-protein ligase MARCHF5(MARCHF5)

Code CSB-CF730492CH
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names MARCH5
Uniprot No. Q5ZJ41
Alternative Names
MARCHF5; MARCH5; RCJMB04_20o22; E3 ubiquitin-protein ligase MARCHF5; Membrane-associated RING finger protein 5; Membrane-associated RING-CH protein V; MARCH-V; RING-type E3 ubiquitin transferase MARCHF5
Species Gallus gallus (Chicken)
Expression Region 1-281
Target Protein Sequence MSEQTGLALPQTMDRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQTCLQRWVDEKQRG NSTARVACPQCNAEYLIVFPKLGPVVYVLDLADRLISKACPFAAAGIMVGSIYWTAVTYG AVTVMQVVGHKEGLDVMERADPLFLLIGLPTIPVMLILGKMIRWEDYVLRLWRKYSNKLQ ILNSIFPGIGCPVPRIPAEANPLADHVSATRILCGALVFPTIATIVGKLMFSSVNSNLQR TILGGIAFVAIKGAFKVYFKQQQYLRQAHRKILNYPEQEGA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length full length protein
Tag Info N-terminal 10xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mitochondrial E3 ubiquitin-protein ligase that plays a crucial role in the control of mitochondrial morphology by acting as a positive regulator of mitochondrial fission. May play a role in the prevention of cell senescence acting as a regulator of mitochondrial quality control.
Subcellular Location Mitochondrion outer membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Database Links

KEGG: gga:423815

STRING: 9031.ENSGALP00000011138

UniGene: Gga.17096

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St Ste 610-322 Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2023 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1