Recombinant Coccidioides immitis Solute carrier family 25 member 38 homolog(CIMG_07070)

Code CSB-CF625177DUV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q1DRJ3
Storage Buffer Tris-based buffer,50% glycerol
Species Coccidioides immitis (strain RS) (Valley fever fungus)
Sequence MSNGSHSSVQLKSSTYLSKPTFHFAAGLLSGLTSSILLQPADLLKTRVQQSRETAALLPT IRSILASPHPIQGLWRGTLPSALRTGFGSALYFTSLNTLRTAVAADDPGYLFRGGHGSKP QNGNSPSGVSASSALPKLSHTANLITGAVARVAAGFVMMPVTVLKVRYESDYYAYRSLWG AAKDIVRHEGVRGLFAGFGATAIRDAPYAGLYVVFYEQSKRSLASLLGASSPSARSTPTE QQKSPPSTASINFISGALAAGLATTITNPFDVVKTRVQLMPSKYKNMMRATALMLREDGM RSLFGGLGLRMGRKALSSALAWTVYEELIMWAEKRWAEEQRDVKGVL
Source in vitro E.coli expression system
Gene Names CIMG_07070
Protein Names Recommended name: Solute carrier family 25 member 38 homolog
Expression Region 1-347
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Mitochondrial carrier required for the biosynthesis of heme, possibly by facilitating 5-aminolevulinate (ALA) production. May act by importing glycine into mitochondria or by exchanging glycine for ALA across the mitochondrial inner membrane.
Subcellular Location Mitochondrion inner membrane, Multi-pass membrane protein
Protein Families Mitochondrial carrier (TC 2.A.29) family, SLC25A38 subfamily
Database Links

KEGG: cim:CIMG_07070

STRING: 246410.XP_001243174.1

Related Products

CIMG_07070 Proteins

CIMG_07070 Proteins for Coccidioides immitis (strain RS) (Valley fever fungus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.