Recombinant Cryptococcus neoformans var. neoformans serotype D 3-ketodihydrosphingosine reductase TSC10(TSC10)

Code CSB-CF317785CTK
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P0CR37
Storage Buffer Tris-based buffer,50% glycerol
Species Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) (Filobasidiella neoformans)
Sequence MPTPLALLLSAILIIGTYFAMPFWPFRKSNYDPRGKHCYITGGSSGLGKALAERLVKQGA HVTIVGRDSKKAEGVVEELKAIAAPGQIIQCIAADLTSPIASTNAIHAACKPHADQAPDY VYLCAGFSRPKLFVETTKQELKDGLDGVYWVSAYTAHEACQMMSKQRRTGKIIFVASFLS YVSFAGYSSYSPAKYALRGLSDALRSEMLLHNIDIHIFLPCGISGPGFDAENRTKPAVTK KIEEGDTPITPEVCAAALESGLKKGYYQITDNLVTEPIRLRSNGGVPTNNFLLDTLWLIV SSVGVPIWRMTADSAVRSFRAKVEKELEAKGYYVS
Source in vitro E.coli expression system
Gene Names TSC10
Protein Names Recommended name: 3-ketodihydrosphingosine reductase TSC10 EC= 1.1.1.102 Alternative name(s): 3-dehydrosphinganine reductase KDS reductase
Expression Region 1-335
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the reduction of 3-ketodihydrosphingosine (KDS) to dihydrosphingosine (DHS).
Subcellular Location Endoplasmic reticulum membrane, Single-pass membrane protein
Protein Families Short-chain dehydrogenases/reductases (SDR) family
Database Links

KEGG: cnb:CNBG4500

STRING: 283643.XP_774150.1

Related Products

TSC10 Proteins

TSC10 Proteins for Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) (Filobasidiella neoformans)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.