Recombinant Dictyostelium discoideum Aquaporin C(wacA)

Code CSB-CF690723DKK
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q54V53
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Dictyostelium discoideum (Slime mold)
Sequence MPFLHLFTPYTNADNTKLILRVNESRLRLFTRQLLAEFFGTLFVVYIVSGSTLAANFAVSDPIVRVCLICLVQGFAFAAIIWSISGISGCQLNPAVTVGCVTTGRMGILNGIAFIIFQCVGALVGAGMMKASLPTFYERDLSATTLATGVNVARGFFLEMVTTSFLVFVVLGVAVYNEWDPKISRVAPLAIGCAVIAGVGFLNLFTGGSLNPARSFGPAVFSDTWHRHYIYWFGPICGGIIAGLFWRIFLSEKVLLIDRPYTDFHRSTYGTATK
Source in vitro E.coli expression system
Gene Names wacA
Protein Names Recommended name: Aquaporin C Alternative name(s): Aquaporin-like protein wacA Water channel protein A
Expression Region 1-274
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May form a water-specific channel.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families MIP/aquaporin (TC 1.A.8) family
Database Links

KEGG: ddi:DDB_G0280537

STRING: 44689.DDB0214915

Related Products

wacA Proteins

wacA Proteins for Dictyostelium discoideum (Slime mold)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.